KEGG   Terriglobus saanensis: AciPR4_3144Help
Entry
AciPR4_3144       CDS       T01408                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
tsa  Terriglobus saanensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AciPR4_3144
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AciPR4_3144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3853188..3853808)
Genome map
AA seq 206 aa AA seqDB search
MIDPCHPGILEVVVGPMFSGKSEELIRRLKRARIARQRVACFKPDIDLRYHRTHIASHSE
QTHEAAVVTPNAERLREALFSTRQIDEVEVVGVDEVQFFDEGILPLTMELVALGKRVIMA
GLDTTFTAEPFGPVPNLMALADKVTKLSAVCMVCGQPAIHTQRLGHSQELVVVGAAGLYE
ARCRMHFHPYVEEGVAEQLELSVVKD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatccatgtcatccggggattctggaagtcgtagttgggcccatgttctcaggc
aaaagcgaagagctgatccgccgcctgaagcgcgcgcggattgcgcggcagcgcgtcgcc
tgcttcaaaccggacatcgatctccgctaccaccggacgcatatcgcgtcgcactccgaa
cagacgcacgaagccgccgtcgtgacgccgaatgcagaacgtctacgcgaggcgctcttc
agtacgcgacagattgacgaggtggaggtcgtcggtgtggatgaggtgcagttcttcgat
gagggcattcttccgctcacgatggaactagtggctctgggcaaacgcgtcattatggca
ggactggatacgacgttcactgcagagcccttcggccctgtgccgaatctcatggcgctt
gcggacaaggtgacgaagctttcggcggtctgcatggtctgcggacagccggcgattcat
acacagcgtctagggcatagccaggagctggtcgtggtgggagctgccgggctctatgaa
gcgcggtgccgtatgcactttcacccatatgtggaagagggtgttgcggaacaactggag
cttagcgtggtgaaggattaa

DBGET integrated database retrieval system