KEGG   Terriglobus saanensis: AciPR4_3148Help
Entry
AciPR4_3148       CDS       T01408                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tsa  Terriglobus saanensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciPR4_3148
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciPR4_3148
   00640 Propanoate metabolism
    AciPR4_3148
   00660 C5-Branched dibasic acid metabolism
    AciPR4_3148
Enzymes [BR:tsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AciPR4_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3855844..3857022
Genome map
AA seq 392 aa AA seqDB search
MKIHEYQAKEILRHYGVPVPEGEMVSTIEEADTAAKQLFSAGNPVVVVKAQIHAGGRGKG
GGVKVTKSLEDANAASKAILGMQLITHQTGPQGQKVQRLLIEAGSAIDRELYLGIVLDRA
TAKLTFMASQAGGMEIEEVAAENPDAIYKEAIEPALGLQPYQARNLAFKLGLKPTQINQA
VQFMIGLYKAFIETDCSLLEINPFITTKDDKLMALDCKINFDDNAMFRHKDLKELRDMAE
EDPLEVEASKDALNYIKLDGNIACMVNGAGLAMATMDIIQYAGGSAANFLDVGGGANQQQ
IEAAFAILLADPNVKAIFINIFGGILRVDVLATAVVAAAKNLNVQLPIILRLEGTNVEEG
RKILADSGLHFEVGATMKEAADLAVVAAKGGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaataccaggccaaagagatcctgcgccactacggcgttccggtccct
gaaggcgaaatggtcagcacgattgaagaagcggacacggcagccaagcagctcttctca
gccggtaaccccgtcgtagtcgtcaaagcgcagatccacgcaggcggtcgcggcaagggt
ggcggcgtcaaggtcaccaagtcgctcgaagacgcgaacgctgcctccaaagccatcctc
ggcatgcagctcatcacgcatcagactggaccgcagggacagaaggtgcagcgccttctc
atcgaagcaggttccgccatcgatcgcgaactctatctcggcatcgtgctcgaccgcgct
accgccaaactgactttcatggcgtcgcaagcgggcggcatggaaatcgaagaggttgcc
gcagagaatcccgacgctatctataaggaagcgatcgaacccgctctcggtctccaaccc
taccaggcgcgcaatctcgcctttaagctgggcctcaagccgacccagatcaaccaggcc
gtccaattcatgattggcctgtacaaagccttcatcgaaaccgactgctccctgcttgag
atcaaccccttcatcaccacgaaggacgacaagctgatggcgcttgactgcaaaatcaac
ttcgacgacaacgcgatgttccgccacaaggacctgaaggaactccgcgacatggccgag
gaagatcccctcgaagtcgaagccagcaaggacgcgctcaactacatcaagctcgacggc
aatatcgcctgcatggtcaacggcgcaggcctcgccatggcgacgatggatatcattcag
tacgctggcggctcagcagcgaacttcctcgacgtgggcggcggtgcaaaccagcagcaa
attgaagccgccttcgcgattcttctcgccgatccgaacgtcaaagcgatcttcatcaac
atctttggcggcattctgcgcgttgatgttcttgcgacagcagtcgttgccgcagcaaag
aacctcaacgtgcagcttcccatcatccttcgcctggaaggtaccaacgtcgaagagggg
cgcaagatccttgcggactccggcctccactttgaagtgggcgcaacgatgaaagaagcc
gccgacctcgccgtcgtcgcagctaagggaggcaagtaa

DBGET integrated database retrieval system