KEGG   Terriglobus saanensis: AciPR4_3148Help
Entry
AciPR4_3148       CDS       T01408                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00020  Citrate cycle (TCA cycle)
tsa00640  Propanoate metabolism
tsa00660  C5-Branched dibasic acid metabolism
tsa01100  Metabolic pathways
tsa01110  Biosynthesis of secondary metabolites
tsa01120  Microbial metabolism in diverse environments
tsa01130  Biosynthesis of antibiotics
tsa01200  Carbon metabolism
Module
tsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AciPR4_3148
   00640 Propanoate metabolism
    AciPR4_3148
   00660 C5-Branched dibasic acid metabolism
    AciPR4_3148
Enzymes [BR:tsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AciPR4_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADV83906
JGI: AciPR4_3148
UniProt: E8V6V4
Position
3855844..3857022
Genome map
AA seq 392 aa AA seqDB search
MKIHEYQAKEILRHYGVPVPEGEMVSTIEEADTAAKQLFSAGNPVVVVKAQIHAGGRGKG
GGVKVTKSLEDANAASKAILGMQLITHQTGPQGQKVQRLLIEAGSAIDRELYLGIVLDRA
TAKLTFMASQAGGMEIEEVAAENPDAIYKEAIEPALGLQPYQARNLAFKLGLKPTQINQA
VQFMIGLYKAFIETDCSLLEINPFITTKDDKLMALDCKINFDDNAMFRHKDLKELRDMAE
EDPLEVEASKDALNYIKLDGNIACMVNGAGLAMATMDIIQYAGGSAANFLDVGGGANQQQ
IEAAFAILLADPNVKAIFINIFGGILRVDVLATAVVAAAKNLNVQLPIILRLEGTNVEEG
RKILADSGLHFEVGATMKEAADLAVVAAKGGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaataccaggccaaagagatcctgcgccactacggcgttccggtccct
gaaggcgaaatggtcagcacgattgaagaagcggacacggcagccaagcagctcttctca
gccggtaaccccgtcgtagtcgtcaaagcgcagatccacgcaggcggtcgcggcaagggt
ggcggcgtcaaggtcaccaagtcgctcgaagacgcgaacgctgcctccaaagccatcctc
ggcatgcagctcatcacgcatcagactggaccgcagggacagaaggtgcagcgccttctc
atcgaagcaggttccgccatcgatcgcgaactctatctcggcatcgtgctcgaccgcgct
accgccaaactgactttcatggcgtcgcaagcgggcggcatggaaatcgaagaggttgcc
gcagagaatcccgacgctatctataaggaagcgatcgaacccgctctcggtctccaaccc
taccaggcgcgcaatctcgcctttaagctgggcctcaagccgacccagatcaaccaggcc
gtccaattcatgattggcctgtacaaagccttcatcgaaaccgactgctccctgcttgag
atcaaccccttcatcaccacgaaggacgacaagctgatggcgcttgactgcaaaatcaac
ttcgacgacaacgcgatgttccgccacaaggacctgaaggaactccgcgacatggccgag
gaagatcccctcgaagtcgaagccagcaaggacgcgctcaactacatcaagctcgacggc
aatatcgcctgcatggtcaacggcgcaggcctcgccatggcgacgatggatatcattcag
tacgctggcggctcagcagcgaacttcctcgacgtgggcggcggtgcaaaccagcagcaa
attgaagccgccttcgcgattcttctcgccgatccgaacgtcaaagcgatcttcatcaac
atctttggcggcattctgcgcgttgatgttcttgcgacagcagtcgttgccgcagcaaag
aacctcaacgtgcagcttcccatcatccttcgcctggaaggtaccaacgtcgaagagggg
cgcaagatccttgcggactccggcctccactttgaagtgggcgcaacgatgaaagaagcc
gccgacctcgccgtcgtcgcagctaagggaggcaagtaa

DBGET integrated database retrieval system