KEGG   Terriglobus saanensis: AciPR4_3479Help
Entry
AciPR4_3479       CDS       T01408                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tsa  Terriglobus saanensis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AciPR4_3479
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AciPR4_3479
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AciPR4_3479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4198636..4199478
Genome map
AA seq 280 aa AA seqDB search
MAKLIDSRYGKARVRVMKLDRSQPQHQLLEWTVRVLLEGDFETAHTVGDNSNILPTDTMK
NTVYSRAKESKAETPEEFAIELAEFLLGRNPQVHTVEVKIETAMWKRLVVDGKPHGSSFM
RGSDELGTVLHHATRETKTMVCGVENMVILKSQNSSFEGYIQDDLTTLKPTADRLFATAM
TADWDYTDGGSAFAARREAIREAMLKAFAEHDSKSVQQTLYAMAEAAMAAVPAVNRVHMV
MPNKHCLLVDLKHFGQENNNEIFVPTEDPHGYIEATVVRE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaactaatcgacagccgatacggcaaggcgcgtgtgcgtgtgatgaagctggac
cgctcgcagccgcagcatcaactgctggagtggacggtgcgtgttctactggaaggcgac
ttcgagaccgcgcacacggtcggcgacaactccaacatcctgccgacggacacgatgaag
aacacggtctactcgcgcgcgaaagagtcgaaggcggagacgccggaagagtttgcaata
gagcttgcggagttccttctgggacgcaatcctcaggtgcacaccgtcgaagtaaagatc
gagacggcgatgtggaagcgcctggtggtggacggcaagcctcacggctcgtcgtttatg
cggggctcggatgagctgggaacggtgctccaccacgcaacgcgcgagacgaagacgatg
gtctgcggtgtggagaacatggtgatcctgaagtcacagaactccagttttgaaggctat
atccaggatgatctgacaacgctgaagccaacggcggaccggctcttcgccacggcaatg
acggcggactgggactacaccgacggaggctctgcgtttgccgcacgacgcgaagcgatc
cgcgaagccatgctgaaggcgttcgccgagcacgattcgaagtcggtgcaacagacgctc
tacgccatggccgaagctgcaatggcggcggtgcctgcagtaaatcgcgtgcatatggtg
atgccgaacaagcactgcctcctggtggacctgaagcacttcggtcaggaaaacaacaac
gaaatctttgtgcctacggaagatccgcacggatacattgaggcgacggtggtgcgcgag
tag

DBGET integrated database retrieval system