KEGG   Terriglobus saanensis: AciPR4_3865Help
Entry
AciPR4_3865       CDS       T01408                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tsa  Terriglobus saanensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AciPR4_3865
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciPR4_3865
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AciPR4_3865
Enzymes [BR:tsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AciPR4_3865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4649833..4650615)
Genome map
AA seq 260 aa AA seqDB search
MAISFKNKPSIVVYLTVGDPDLETTYDIALAALDNGAEVLELGVPFSDPLADGPVIQRAS
ERAVARGTRLTDVLALSKKIREARPEAGIVLFSYLNPVVRVGMVEFCKLAKESGADGVLL
TDLIVEEADEYLAAMHANGLQPIFLAAVTSPDQRLKAIAENSQGFVYAISRTGITGTQTS
AFTSEAEDLVARLRKFAGDLPIAIGFGVSNPGHVAAIAKFADAAVVGSAIVKLIEDTPAT
EAAQAVGQFIRTLRGGAESI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttccttcaagaacaaacccagcatcgtcgtctacctgaccgtgggcgatccc
gatcttgagacgacctacgacattgccctggctgctctggataacggagcggaggtgctg
gagcttggtgttccgttctccgatcccctggccgatggccctgtgatccaacgagcgagt
gaacgtgccgtggctcgcgggacgcgcctgaccgatgtgctcgcgctatcaaaaaagatc
cgcgaagcgcgtccggaagcagggatcgtgttgttcagctacctgaatcctgtggtgcgc
gtgggcatggttgagttctgcaagctcgcgaaagaaagcggcgcggacggtgttctgctc
accgatctgatcgtcgaagaagcggacgagtatctcgcggcgatgcatgcgaacggtctg
cagccgatcttcctggcggcggttaccagtccggatcaacggctgaaggcgattgcggag
aactcgcagggcttcgtgtatgcgatttcgcgcacgggcattacgggtacgcagacctct
gcgtttaccagcgaggcggaagatctcgtggcgcggctgcgcaaatttgcgggcgatctt
cccattgcgatcggatttggcgtctccaacccgggacacgtcgccgccattgcgaagttc
gcggatgccgctgtggtgggctccgccattgtgaaattgattgaagatacccctgcaaca
gaagctgcccaggccgtgggccagttcatccgtacccttcgcggcggcgctgaatcgata
tga

DBGET integrated database retrieval system