KEGG   Terriglobus saanensis: AciPR4_3870Help
Entry
AciPR4_3870       CDS       T01408                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
tsa  Terriglobus saanensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AciPR4_3870
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AciPR4_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4654642..4655418
Genome map
AA seq 258 aa AA seqDB search
MKRLGAVIVLSAVSLTGLAFVHPFGNPRVEPAKGLDTLFQGARMSSDTKRVLVTKCADCH
SNETRWPVYARLAPGSWLIERDIVEARRKMNLSLWDQMPADAQSVLAGQIIHEAKSGDMP
PLQYRLLHWNSELTATDIAALSMMETGAQQEASVGGSGDAARGKSVFDKRCTGCHAMEGD
REGPRLAGVFGRKAGSVAGFDYSAGLKNSGITWDETTLEKWLSDPDTLVPDNKMDFHVPA
AQERSDLIAYFKHQKGQN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgccttggtgctgtgatcgtgctttctgctgtttctctcacgggacttgcgttt
gtacatcccttcggtaatccgcgtgtcgagcccgcaaaggggctcgacacgttgtttcaa
ggcgccaggatgtcttcggatacaaaaagggttctggttacgaagtgcgctgactgccac
tcaaacgagacgcggtggccggtctatgcacgtctggcacctggttcctggctgatcgag
cgggatatcgttgaggcgcgcaggaagatgaatctctcgctttgggaccagatgcccgcc
gatgcgcagagtgtattggccggacagatcattcatgaagcgaagagtggggacatgcca
cctctgcaataccgtcttctgcattggaactccgagctgacagcaacggacattgcagcg
ctctcgatgatggaaaccggggcgcaacaggaggcgagcgtgggcggctccggcgatgcc
gcgcgcggcaagtccgtattcgataagcgatgcaccggctgtcatgcgatggagggagat
cgggaagggccgaggcttgccggagtctttggcagaaaggctggaagcgtggcaggcttc
gactactctgccgggttgaagaactccggaatcacatgggatgaaaccacgttggagaaa
tggctcagcgatcccgacacgttagtgcctgacaacaagatggacttccatgttccggcc
gcccaggaacgctccgatttgatcgcctatttcaaacatcaaaagggtcagaactag

DBGET integrated database retrieval system