KEGG   Terriglobus saanensis: AciPR4_3906Help
Entry
AciPR4_3906       CDS       T01408                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tsa  Terriglobus saanensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciPR4_3906
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AciPR4_3906
Exosome [BR:tsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AciPR4_3906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4692147..4693649
Genome map
AA seq 500 aa AA seqDB search
MAKYVLALDQGTTSSRAILFDHDGTIVGTAQHEFKQIFPTGKNGWVEHDAFEILTSQMSA
AVEVMGKTGTRPRDVAALGITNQRETVVVWDRETGKPIYNAIVWQDRRTADVCARLVSEG
AEETVRAKTGLRLDPYFSGTKVAWILDNVDGARAKADAGKLAFGTVDSWLVWNLTSGARH
VTDRTNASRTLLYNIVEDKWDDDLLTLLNVPRSIMPDVVWSSEKLGMVTTTLGLGEIEIA
GIAGDQQSALFGQLCVEPGSAKNTYGTGCFLLQHIGYDFKISDQRLLTTLACSVDRKLEY
ALEGSVFIGGAVVQWLRDQMKFFAKSSDVEAMAATVKNSGGVVFIPAFTGLGAPHWDPYA
SGTIIGLQRGTERGHIARAAVESIALQVADVQRAMNNDTPVPLKTLRVDGGAASNDMLMQ
FQADILGVRVERPAVVETTAMGAAYLAGIATGFWSGVEEIRKHQGIGKAFEPKADRAEMD
LLIARWQEAVSRSLGWNAPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtatgttttggcgctggaccagggaactaccagctcgcgcgcaatcctgttc
gatcacgacggcacgatcgtaggcactgctcagcacgagttcaagcagatctttcctacg
ggtaaaaacggctgggtggagcatgacgcctttgaaattctcacctcgcagatgtccgcc
gccgtggaagtcatgggcaaaactggcacgcgtccacgcgatgtcgccgcgcttggcatc
accaatcagcgcgagaccgtcgtcgtgtgggaccgcgaaacgggcaagcctatctacaac
gccatcgtttggcaggaccgccgcaccgcggatgtctgcgcgcgtctcgtgagcgaaggc
gcggaagagacggtccgcgcaaagaccggtctgcgtctcgatccatacttttccggcacc
aaggtcgcatggattctcgacaacgtggatggcgcacgcgccaaggcagacgcgggcaag
ctcgccttcggcaccgtggatagctggctcgtctggaacctcacgagcggtgcacgccat
gtgacggatcgtacgaatgcgtcacgcacgttgctctacaacattgtggaagacaagtgg
gacgacgacctgctgacactgctcaatgtgccgcgcagcataatgccggatgtggtctgg
tcgagcgagaagctcggtatggtcacgacgacactcggtctcggcgagatagaaatcgca
ggcatcgcgggcgatcagcagagcgcgctctttggccagctctgcgtcgaacccggcagc
gctaagaacacctacggcacgggctgcttccttctccagcacatcggctacgacttcaag
atcagcgaccagcgcctgctcaccacgctcgcctgctccgtcgatcgcaaactggagtac
gcgctcgaaggctcggtcttcatcggcggcgcggtggtgcagtggctacgtgaccagatg
aagttcttcgcgaaatcgagtgatgtggaagcgatggctgcaacggtgaagaactccggt
ggagtcgtcttcattcccgcgttcacaggtctcggcgcgccgcactgggacccttatgcc
agtggaaccatcatcggtctgcaacgcggcacagagcgaggacatattgcacgcgccgcg
gtggaaagcatcgccctgcaggttgccgatgtgcagcgtgccatgaataacgacacgccg
gtgccactgaagactctgcgtgtggatggaggcgcggcttcgaacgacatgctgatgcag
tttcaggcagacatccttggcgtgcgcgtggagcgccctgccgtggtagaaaccaccgcg
atgggcgcagcgtatcttgcaggaattgccacaggtttctggagcggtgtggaagagatt
cgcaaacaccaggggatcggaaaggcctttgaaccgaaggctgatcgcgcggagatggat
ttgctgattgcgcgatggcaggaggctgtcagcaggtcgcttggttggaatgcaccacga
tga

DBGET integrated database retrieval system