KEGG   Terriglobus saanensis: AciPR4_3909Help
Entry
AciPR4_3909       CDS       T01408                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tsa  Terriglobus saanensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AciPR4_3909
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AciPR4_3909
Enzymes [BR:tsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AciPR4_3909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4696198..4696767)
Genome map
AA seq 189 aa AA seqDB search
MYSMSMANDLYSIPLQRIDGETTSLAPYRGKVLLVVNVASKCGLTKQYDALEKLYARFRE
NGLEILGLPANDFAGQEPGSNDEIATFCKSTFGVEFPLFSKITVTGPEKHPLYRALIAAK
PTSVGEGKQSFIEGLVKYGISPNKEPELLWNFEKFLVARDGQIVARFSPDTLPDDAVIVK
AIEAELAKK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtactctatgtctatggcgaacgatctctattccattcctctccagcgcattgacggc
gagaccacctcccttgctccctatcgtggcaaggtgttgctcgtcgtcaatgtcgcttcc
aagtgcggcctgacgaaacagtacgacgcgctcgaaaagctgtacgcgcgctttcgcgaa
aacggcctcgaaatcctcggacttccggcgaacgactttgccggtcaagagccgggatcc
aacgacgagattgccaccttctgtaaatcgacctttggcgtcgaattcccactcttttcg
aagatcaccgtaaccggaccggaaaagcatccgctctatcgggcgctcatcgctgctaaa
cctacctccgtcggtgaagggaagcagtcttttatcgagggattggtgaagtacggtatc
tcgccgaataaggagcctgagcttctttggaacttcgagaaatttcttgtggcgagggat
gggcagatcgtcgcacggttctccccagacacgctgccggatgatgctgtgattgtgaag
gcgattgaagcggagcttgctaagaagtaa

DBGET integrated database retrieval system