KEGG   Terriglobus saanensis: AciPR4_4023Help
Entry
AciPR4_4023       CDS       T01408                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tsa  Terriglobus saanensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AciPR4_4023
Enzymes [BR:tsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AciPR4_4023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4815487..4815951
Genome map
AA seq 154 aa AA seqDB search
MKAAVALGANLGDREASLRDAVHRLGALGEVVAVSSFFDTEPVGYVDQPPFLNGACVVET
SLTPLALLRGLLAIEVEMGRDRSHGIAKGPRVIDLDLLLYEDLTMASAELTLPHPEMAGR
RFVLEPLAEVAGDWFVPRTDATVGELLQRLLPNA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgcactgggcgctaacttaggagaccgcgaggcttcgctgcgtgat
gcggtccatcgcttaggcgcactcggcgaggtcgttgccgtctcttcgttcttcgataca
gagcccgtgggctatgtcgatcagccgccgttcctgaacggagcctgcgtggtggagact
tcgctcactcctcttgcattgctgcgcggtctgcttgcgatcgaggtggagatggggcgc
gaccgctcgcacgggattgcgaaagggccgcgtgtgatcgatctggacttgctgctctat
gaagatctgacgatggcttcggcggagctgacgctgcctcatcccgagatggcgggccgt
cgatttgtgctggaaccattggccgaggtagccggagactggtttgttccacgaaccgat
gcgacggtcggtgagttgttgcaacgacttctaccgaacgcgtag

DBGET integrated database retrieval system