KEGG   Terriglobus saanensis: AciPR4_4235Help
Entry
AciPR4_4235       CDS       T01408                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tsa  Terriglobus saanensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tsa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5038447..5039043
Genome map
AA seq 198 aa AA seqDB search
MIAHLRGRLLAKSPNQAIVECGGVGYDVAISVTTFSALKSEGAEVELFINTQVREDAIAL
FGFAEMEEKRLFEKLITVSGIGPKLGITVLSGIAAPLLVAAIKGSDHATLQKIPGIGKKT
AERVVVELKDKLEDMISAPSADPGFHAGPAGDDVLSALANLGYQKAAAQRAIQTAIEQEP
ALRTEFEKLFRAAMGAMR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcatctacgtggacgtttgcttgcgaagtcgccgaaccaggcgattgtggag
tgtgggggtgtgggatacgacgtcgcgatcagcgtgacgacgttttccgcgctgaagagt
gagggcgcggaggtggagctcttcatcaatacgcaggtgcgcgaggatgccatcgccctc
tttggatttgcggagatggaggagaagcggctgtttgaaaagctgattaccgtctccggc
atcgggccgaagctgggcattacggtgttgagcgggattgcggcgcctctgttggtggcg
gcgatcaaggggtccgaccatgcgacgctgcaaaaaattcctgggattgggaagaaaacc
gctgaacgagttgttgttgagttgaaggacaaactggaggacatgatcagtgcgccttcg
gcggacccgggcttccacgctggaccggcgggagacgatgtgctttcggcactggcaaat
cttgggtatcagaaggcggcggcgcagcgcgcgatccagacggcgatcgaacaggagcct
gcgttgcggacggagtttgaaaagttatttcgtgcggccatgggggctatgcggtaa

DBGET integrated database retrieval system