KEGG   Thermus scotoductus: TSC_c00500Help
Entry
TSC_c00500        CDS       T01414                                 

Gene name
aor
Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tsc  Thermus scotoductus
Pathway
tsc00030  Pentose phosphate pathway
tsc01100  Metabolic pathways
tsc01120  Microbial metabolism in diverse environments
tsc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TSC_c00500 (aor)
Enzymes [BR:tsc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TSC_c00500 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADW20703
UniProt: E8PR43
Position
complement(41091..42914)
Genome map
AA seq 607 aa AA seqDB search
MLGGYAHKLARINLSTGQVEYFAPDPKDLEMYVGGRGLGVKYVFENGPKVDPLGPDNLLC
FMNGPLSGTRAKMSGRLAVVTKSPLTGTVTDSHMGGWTAAKLKWAGFDGLLIKGASDKPV
YLLVKDGEVTLHDASDIWGKTTHETHRILRERHGEDADVMAIGPAGENLVRFANWINNDE
RAAGRGGTGAVAGSKKLKAIVVVGKQENMPQPKDPELWREADRQASATINDPKNVTAPKK
GGLSLYGTNVLMNITNVMGALPTFNAQHTCIEGVETISGEYIREHRLIKDNTCHACPVAC
KKMVEVHINGKAIRFESYEYESAWALGAHSGHTDTDWTGYAIYLCNAYGMDTIETGNAIA
VLMEATEKGYYQGPDGIRFGDKEGEARIIEAIAYRRGVGDSLAEGPARFAKAIGHPEIAL
EVKGQSIPAYDPRGLKGMGIAYATSNRGACHLRAYTPASEILGVPYKTDPLAWEGKGKLT
KLFQDLSAFTDSLDLCKFSQFAEGPEEYAKQLAAYWGRPVTPEEILLIGERIYNLERYYN
NLAGWAEGSDYLPERFLKEPSDCAGSKGQLTELDLMLQEYYQERGWEKGVVPPAKLQALG
ILSAAAD
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtggatatgcccataagctcgcccgtatcaacctctcgacaggccaggtggag
tacttcgcccccgaccccaaggacctggagatgtatgtgggcggaaggggtctcggggtc
aagtatgtgtttgaaaacgggcccaaagtagatccccttggccccgacaacctcctttgc
ttcatgaatggtcccctttccggcacccgggccaagatgtcggggcgcctggcggtggtc
accaaaagccccctcacgggcacggtaacggatagccacatggggggctggaccgcggcc
aagctgaagtgggcggggttcgacgggctcctcatcaagggagcctcggacaaacccgtt
tacctgctggtgaaggatggggaggtcaccctccacgatgcctcggacatatggggcaag
accacccatgaaacccaccgcatcctgcgggaacgccacggggaggatgccgacgtgatg
gccatcggccccgccggggaaaacctggtgcgcttcgccaactggatcaacaacgacgag
cgcgctgccggccgagggggcaccggggcggtagcggggagcaagaagctcaaggccatc
gtggtggtgggcaagcaggagaacatgccccagcccaaggaccccgagctctggcgggag
gccgaccgccaggcctcggccaccatcaacgaccccaagaacgtgaccgcccccaagaag
ggtgggctttccctctacggcaccaacgtgctcatgaacatcaccaacgtgatgggggcc
ctgcccaccttcaacgcccagcacacctgcattgaaggcgtggaaaccatctccggggag
tacatccgcgagcaccgcctcatcaaggacaacacctgccacgcctgccccgtggcctgc
aagaagatggtggaggtccacatcaacggcaaggccatccgcttcgaatcctacgagtac
gagtccgcctgggccttgggggcccactccggccacaccgacaccgactggaccgggtac
gccatctacctctgcaacgcctacggcatggacaccatcgagacgggtaacgccatcgcc
gtcctcatggaggccacggagaagggctactaccagggccctgacgggatccgctttggg
gacaaggagggcgaggcccgcatcatcgaggccatcgcctaccgccggggagtgggagac
agcctggcggaaggcccggcccgctttgccaaggccatcggccaccccgagattgccctc
gaggtcaaggggcagtccatccccgcctacgacccccggggcctcaagggcatgggcatc
gcctacgccacctccaaccgcggggcctgccacctccgggcctacacccccgcctcggag
atccttggggtgccctacaagaccgaccccctggcctgggaggggaagggcaagctcacc
aagctcttccaggacctctccgccttcaccgactccttggacctttgcaagttcagccag
ttcgccgagggtcccgaggagtacgccaagcagcttgccgcctactggggccggcccgtg
acccccgaggagatcctcctcatcggggagcgcatctacaacctggagcgctactacaac
aacctggcaggctgggcggaaggctccgactacctgcccgagcgcttcctcaaggaaccc
tccgactgcgcaggctccaagggccagctcacggagctggacctgatgttgcaggaatac
taccaggagcggggttgggagaagggggtggtgcccccggccaagctccaggccttgggc
attctgtccgccgccgccgactag

DBGET integrated database retrieval system