KEGG   Thermus scotoductus: TSC_c00500Help
Entry
TSC_c00500        CDS       T01414                                 

Gene name
aor
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tsc  Thermus scotoductus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tsc01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tsc00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41091..42914)
Genome map
AA seq 607 aa AA seqDB search
MLGGYAHKLARINLSTGQVEYFAPDPKDLEMYVGGRGLGVKYVFENGPKVDPLGPDNLLC
FMNGPLSGTRAKMSGRLAVVTKSPLTGTVTDSHMGGWTAAKLKWAGFDGLLIKGASDKPV
YLLVKDGEVTLHDASDIWGKTTHETHRILRERHGEDADVMAIGPAGENLVRFANWINNDE
RAAGRGGTGAVAGSKKLKAIVVVGKQENMPQPKDPELWREADRQASATINDPKNVTAPKK
GGLSLYGTNVLMNITNVMGALPTFNAQHTCIEGVETISGEYIREHRLIKDNTCHACPVAC
KKMVEVHINGKAIRFESYEYESAWALGAHSGHTDTDWTGYAIYLCNAYGMDTIETGNAIA
VLMEATEKGYYQGPDGIRFGDKEGEARIIEAIAYRRGVGDSLAEGPARFAKAIGHPEIAL
EVKGQSIPAYDPRGLKGMGIAYATSNRGACHLRAYTPASEILGVPYKTDPLAWEGKGKLT
KLFQDLSAFTDSLDLCKFSQFAEGPEEYAKQLAAYWGRPVTPEEILLIGERIYNLERYYN
NLAGWAEGSDYLPERFLKEPSDCAGSKGQLTELDLMLQEYYQERGWEKGVVPPAKLQALG
ILSAAAD
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtggatatgcccataagctcgcccgtatcaacctctcgacaggccaggtggag
tacttcgcccccgaccccaaggacctggagatgtatgtgggcggaaggggtctcggggtc
aagtatgtgtttgaaaacgggcccaaagtagatccccttggccccgacaacctcctttgc
ttcatgaatggtcccctttccggcacccgggccaagatgtcggggcgcctggcggtggtc
accaaaagccccctcacgggcacggtaacggatagccacatggggggctggaccgcggcc
aagctgaagtgggcggggttcgacgggctcctcatcaagggagcctcggacaaacccgtt
tacctgctggtgaaggatggggaggtcaccctccacgatgcctcggacatatggggcaag
accacccatgaaacccaccgcatcctgcgggaacgccacggggaggatgccgacgtgatg
gccatcggccccgccggggaaaacctggtgcgcttcgccaactggatcaacaacgacgag
cgcgctgccggccgagggggcaccggggcggtagcggggagcaagaagctcaaggccatc
gtggtggtgggcaagcaggagaacatgccccagcccaaggaccccgagctctggcgggag
gccgaccgccaggcctcggccaccatcaacgaccccaagaacgtgaccgcccccaagaag
ggtgggctttccctctacggcaccaacgtgctcatgaacatcaccaacgtgatgggggcc
ctgcccaccttcaacgcccagcacacctgcattgaaggcgtggaaaccatctccggggag
tacatccgcgagcaccgcctcatcaaggacaacacctgccacgcctgccccgtggcctgc
aagaagatggtggaggtccacatcaacggcaaggccatccgcttcgaatcctacgagtac
gagtccgcctgggccttgggggcccactccggccacaccgacaccgactggaccgggtac
gccatctacctctgcaacgcctacggcatggacaccatcgagacgggtaacgccatcgcc
gtcctcatggaggccacggagaagggctactaccagggccctgacgggatccgctttggg
gacaaggagggcgaggcccgcatcatcgaggccatcgcctaccgccggggagtgggagac
agcctggcggaaggcccggcccgctttgccaaggccatcggccaccccgagattgccctc
gaggtcaaggggcagtccatccccgcctacgacccccggggcctcaagggcatgggcatc
gcctacgccacctccaaccgcggggcctgccacctccgggcctacacccccgcctcggag
atccttggggtgccctacaagaccgaccccctggcctgggaggggaagggcaagctcacc
aagctcttccaggacctctccgccttcaccgactccttggacctttgcaagttcagccag
ttcgccgagggtcccgaggagtacgccaagcagcttgccgcctactggggccggcccgtg
acccccgaggagatcctcctcatcggggagcgcatctacaacctggagcgctactacaac
aacctggcaggctgggcggaaggctccgactacctgcccgagcgcttcctcaaggaaccc
tccgactgcgcaggctccaagggccagctcacggagctggacctgatgttgcaggaatac
taccaggagcggggttgggagaagggggtggtgcccccggccaagctccaggccttgggc
attctgtccgccgccgccgactag

DBGET integrated database retrieval system