KEGG   Thermus scotoductus: TSC_c02690Help
Entry
TSC_c02690        CDS       T01414                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tsc  Thermus scotoductus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c02690 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TSC_c02690 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    TSC_c02690 (sucB)
Enzymes [BR:tsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TSC_c02690 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229375..230583
Genome map
AA seq 402 aa AA seqDB search
MQELKVPSVGESIVEVEIGAWLKKEGESFAQDEPLVELITDKATLELPAPFAGTLERILK
RTGETARVGEAIALLKALGEGLPRPEPEAVVPQAPEPQEPLAMPAAERVLREAGVSPGEV
VGTGLGGRILKEDVERHLEERARQAPPQAVPSRMPEPAPLPAQPPADRPWRVSEAVPMSP
LRRRIAERLLLARQTTAMLTTFNEADMSAIIALRRELGEAFQKKHGVKLGFMSFFVKAVV
QALKEIPELNAEIRDNTILYHRYYDIGVAVGGGEGLVVPVIRDADRLSFAEIERQIADFA
ERARTKKLKPEELMGGTFTITNGGVYGSLNSTPLLNPPQVGILGMHAIQERPVAREGQVV
VRPMMYLALSYDHRIVDGREAVTFLRRVKELVENPVRLLLEV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaactgaaagtgccctccgtgggcgagtccatcgtggaagtggagatcggcgcc
tggctgaagaaggaaggggaaagctttgcccaggatgagcccctggtggagctcatcacc
gacaaggccaccctggagcttcccgccccctttgcgggaaccctggagcggatcctgaag
cgcaccggggaaaccgccagggtgggggaggccatcgcccttcttaaggccttgggagag
gggcttccccggcctgagcccgaggctgtggtaccccaggcacccgagccccaagagccc
ctggccatgcccgccgcggagcgggttttgcgggaggcgggggtatcccccggggaggtg
gtgggcacgggcctgggcgggcggatcctcaaggaggacgtggagcgccacctggaggag
agggccaggcaggccccaccccaggcggtgccttcccggatgccggagcccgcgccgctt
cccgcccaacccccggccgaccgcccctggcgggtgagcgaggcggtgcccatgagcccc
ttgcgccgccgcattgcggaaaggctcctcctggcccggcagaccacggccatgctcacc
accttcaacgaggcggatatgtccgccatcatcgccttgaggagggagctgggggaggcc
ttccagaagaagcacggggtgaagctgggcttcatgagcttcttcgtgaaggccgtggtc
caggccctcaaggagattcccgagctcaacgccgagatccgggacaacaccatcctctac
caccgctactacgacatcggggtggccgtggggggtggggaggggctggtggtgcccgtg
atccgggatgccgaccggctttccttcgccgagatcgagcgccagatcgccgacttcgcc
gaaagggcccgcaccaagaagctgaagcccgaggagctcatggggggcaccttcaccatc
accaacgggggggtgtacggctccctcaactccactcccctcctcaacccccctcaggtg
ggcatcctgggcatgcacgccatccaggaaaggcccgtggcccgggaggggcaggtggtg
gtccggcccatgatgtacctggccctttcctacgaccaccgcatcgtggacggccgggag
gcggtgacctttttgaggcgggtcaaggaactggtggaaaaccccgtgcgcctcttgttg
gaggtctag

DBGET integrated database retrieval system