KEGG   Thermus scotoductus: TSC_c03350Help
Entry
TSC_c03350        CDS       T01414                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tsc  Thermus scotoductus
Pathway
tsc00900  Terpenoid backbone biosynthesis
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TSC_c03350 (ispE)
Enzymes [BR:tsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     TSC_c03350 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADW20974
UniProt: E8PKT0
Position
287653..288471
Genome map
AA seq 272 aa AA seqDB search
MERLAVAKVNLGLSLLGRRPDGYHELHTLFASLSFGDRLFLEPIPEGIEFRGRYGKRNLA
YRAAAAYLEAAGWPGGVRIVLEKALPEGAGLGGGSSDAAQVLLGLKELYPAEVDLSSLAL
SLGADVPFFLQGGVAEARGVGERLRPLSLSPLPVVVFSLGLRLPTPRVYGEVKPHDFGPE
LPVSEILEALEKGEEPPYWNSLEGPAFRLHPELKEVKARLKALGLRGVLMSGSGSAFFGL
AEDEAQAKKAVGALRHSGYARHGILGGGYGVI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcctagcggtggccaaggtgaacctgggcctctccctcctggggaggaggccg
gatggctaccacgagctccacaccctcttcgccagcctatccttcggggaccggcttttc
ctggagcccatccccgaggggatcgagttccgcgggcggtacgggaaaaggaacctggcc
taccgggcggcggcggcctacctggaggcggcgggctggcccgggggggtgcggatcgtc
ctggaaaaagccctgcccgagggggcgggtcttggcggggggagttcggatgccgcccag
gtgcttctgggcctcaaggagctctatccggcggaggtggacctatcctccttggccctt
tccctgggggccgatgtgcccttcttcctccagggaggggtggcggaggcccggggggtg
ggggagaggctcaggcccctttccctttcccccttgccggtggtggtcttctccttgggc
ctgcgccttcccacccccagggtgtatggggaggtgaagcctcacgatttcgggcccgag
cttccggtttcggagatcctcgaggccctggagaaaggggaggagccaccctattggaat
agcctcgagggccctgccttccgccttcatccggagctgaaggaggtgaaggcccggctt
aaggccttgggtttgaggggcgttttaatgtccggctcggggagcgccttcttcggcctg
gcggaggacgaggcccaggccaagaaggcggtgggggccctgaggcatagcggttatgcc
cggcacggaattctggggggagggtatggagttatttag

DBGET integrated database retrieval system