KEGG   Thermus scotoductus: TSC_c04250Help
Entry
TSC_c04250        CDS       T01414                                 

Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tsc  Thermus scotoductus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TSC_c04250
Enzymes [BR:tsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TSC_c04250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
372601..373179
Genome map
AA seq 192 aa AA seqDB search
MLAKLYSAFRQVGEDLFHQRLISATAGNFSVRTKEGFLITKSGVQKARLTPEDLVEVPLE
GPFPEGASVESVIHREVYRATPARAIVHAHPRVAVALSLHLDRIVPLDLEGQYYLKEVPV
LAPKTTSATLEAALAVAEGLKEHRACLLRGHGAFAIGLKEKPEEALLEAYSLLTALEESA
EILFYHRLWGKG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgctggctaagctttattcggcctttcgccaggtgggggaggatcttttccaccagagg
ctcatctccgccaccgcgggcaacttttccgtgcgcaccaaggagggctttctcattacc
aaaagcggggtgcagaaggcccgcctgacccccgaggacctggtggaggtgcccctcgag
ggccctttcccggaaggggccagcgtggagagcgtgatccaccgggaggtgtaccgggcg
accccggcccgggccatcgtccatgcccatccccgggtggcggtggctctttccttgcac
ctggaccggattgttcccctggacctcgagggccagtactacctgaaggaggttcccgtg
cttgcccccaagaccacaagcgccaccctggaggccgctttggccgtggcggagggcctt
aaggagcaccgagcctgcctgttaaggggccacggggcctttgccatagggcttaaggag
aagccggaggaagcccttctggaggcctatagcctcctcaccgccttggaggaaagcgcg
gagatcctcttctaccaccgcctttgggggaagggatga

DBGET integrated database retrieval system