KEGG   Thermus scotoductus: TSC_c05440Help
Entry
TSC_c05440        CDS       T01414                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tsc  Thermus scotoductus
Pathway
tsc00620  Pyruvate metabolism
tsc00630  Glyoxylate and dicarboxylate metabolism
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01200  Carbon metabolism
Module
tsc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSC_c05440 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    TSC_c05440 (aceB)
Enzymes [BR:tsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TSC_c05440 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADW21176
UniProt: E8PLU1
Position
complement(495138..496700)
Genome map
AA seq 520 aa AA seqDB search
MKGVEILKDHPLLGEVLTEEALRFVVALHREFNPVRKALLERRKTLWERYKAGEKPDFPE
ETAFVRGGSWQVAEAPPDLLDRRVEITGPVDRKMIINALNSGAKVFMADFEDALSPTWDN
VIQGQKNLYDAVRRQIDFVSPEGKEYKLKEKVATLVVRPRGWHLVEKHVRVDGEPISASL
FDFGLYFFHNAHELLRRGSGPYFYLPKMESHLEARLWNQVFNFAQDYLGIPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHIHGAHAIGGMAAFIPSRKDPEVNERAFHQVRADKEREASQGFDGTWVAH
PDLVPVAQEVFDRYLGDKPHQKHVKREDVQVRAEDLLNFEVPGGKVTEAGLRNNISVALQ
YLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHRQATLEDGRTVTPELYQKIKEEEL
AKLGGREVGRYKEAEEILDKLVLSEEFIEFLTLVAYDYLD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggaaatcctcaaagaccatcccctcttaggagaggtgctcacggaagag
gccctgaggttcgtggtggccctgcaccgggagttcaaccccgtgcgcaaggcgcttttg
gagcgcaggaaaaccctctgggaaaggtacaaggccggggaaaaaccggactttcccgag
gaaaccgccttcgtgcggggcgggtcctggcaggtggcagaagccccacccgaccttttg
gaccgccgggtggagatcaccggccctgtggaccgcaagatgatcatcaacgccctgaac
tccggggccaaggtcttcatggcggattttgaagacgccctctcccccacctgggacaac
gtgatccaggggcagaagaacctctatgacgccgtccgccgccagattgactttgtaagc
cccgaggggaaggagtacaagctgaaggaaaaggtagccaccctggtggtccggccccgg
ggatggcacctggtggaaaagcacgtgcgggtggacggggagcccatttccgcaagcctc
tttgactttggcctttacttcttccacaacgcccacgagctcctaaggcggggaagcggc
ccctacttctacctgcccaagatggaaagccacctggaggcccggctttggaaccaggtc
ttcaacttcgcccaggactacctgggcatcccccggggcaccatccgggccacggtgctc
atcgaaaccatcctggcggccttcgagatggaggagatcctctacgagcttaaggagcac
gccgccgggctcaacgccggccgctgggactacatcttcagctgcatcaagaagttcgcc
accaccgcccccatcttccccgaccgggcccaggtcaccatgaccgtgcccttcatgaag
gcctacaccgagcttctggtgaagtcctgccatatccacggggcccacgccatcgggggc
atggccgccttcatccccagccgcaaggaccctgaggtgaacgaaagggccttccaccag
gtgcgggccgacaaggagcgggaagcctcccagggatttgacggcacctgggtggcccac
cccgatctggtgcccgtggcccaggaggtcttcgaccggtacctgggggataagccccac
cagaagcacgtgaagcgggaggacgtccaggtgagggcggaggacctgctgaactttgag
gtcccgggaggcaaggtaacggaggcaggccttcgcaacaacatctccgtggccctccag
tacctgaaccagtggcttctcggcaacggggccgccgccatcttcaacctcatggaggat
gccgccaccgccgagatcagcagggcgcagctctggcaatgggtgcaccggcaggccacc
ttggaggacggccgcacggtcacccctgagctttaccaaaagatcaaggaagaggagctc
gccaagctgggaggacgggaggttggccgctataaggaggccgaggagatcctggacaag
ctggtcctctcggaggagttcatcgagttcctgaccctggtggcctacgattacctggac
tga

DBGET integrated database retrieval system