KEGG   Thermus scotoductus: TSC_c05440Help
Entry
TSC_c05440        CDS       T01414                                 

Gene name
aceB
Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tsc  Thermus scotoductus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c05440 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSC_c05440 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    TSC_c05440 (aceB)
Enzymes [BR:tsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TSC_c05440 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(495138..496700)
Genome map
AA seq 520 aa AA seqDB search
MKGVEILKDHPLLGEVLTEEALRFVVALHREFNPVRKALLERRKTLWERYKAGEKPDFPE
ETAFVRGGSWQVAEAPPDLLDRRVEITGPVDRKMIINALNSGAKVFMADFEDALSPTWDN
VIQGQKNLYDAVRRQIDFVSPEGKEYKLKEKVATLVVRPRGWHLVEKHVRVDGEPISASL
FDFGLYFFHNAHELLRRGSGPYFYLPKMESHLEARLWNQVFNFAQDYLGIPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHIHGAHAIGGMAAFIPSRKDPEVNERAFHQVRADKEREASQGFDGTWVAH
PDLVPVAQEVFDRYLGDKPHQKHVKREDVQVRAEDLLNFEVPGGKVTEAGLRNNISVALQ
YLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHRQATLEDGRTVTPELYQKIKEEEL
AKLGGREVGRYKEAEEILDKLVLSEEFIEFLTLVAYDYLD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggaaatcctcaaagaccatcccctcttaggagaggtgctcacggaagag
gccctgaggttcgtggtggccctgcaccgggagttcaaccccgtgcgcaaggcgcttttg
gagcgcaggaaaaccctctgggaaaggtacaaggccggggaaaaaccggactttcccgag
gaaaccgccttcgtgcggggcgggtcctggcaggtggcagaagccccacccgaccttttg
gaccgccgggtggagatcaccggccctgtggaccgcaagatgatcatcaacgccctgaac
tccggggccaaggtcttcatggcggattttgaagacgccctctcccccacctgggacaac
gtgatccaggggcagaagaacctctatgacgccgtccgccgccagattgactttgtaagc
cccgaggggaaggagtacaagctgaaggaaaaggtagccaccctggtggtccggccccgg
ggatggcacctggtggaaaagcacgtgcgggtggacggggagcccatttccgcaagcctc
tttgactttggcctttacttcttccacaacgcccacgagctcctaaggcggggaagcggc
ccctacttctacctgcccaagatggaaagccacctggaggcccggctttggaaccaggtc
ttcaacttcgcccaggactacctgggcatcccccggggcaccatccgggccacggtgctc
atcgaaaccatcctggcggccttcgagatggaggagatcctctacgagcttaaggagcac
gccgccgggctcaacgccggccgctgggactacatcttcagctgcatcaagaagttcgcc
accaccgcccccatcttccccgaccgggcccaggtcaccatgaccgtgcccttcatgaag
gcctacaccgagcttctggtgaagtcctgccatatccacggggcccacgccatcgggggc
atggccgccttcatccccagccgcaaggaccctgaggtgaacgaaagggccttccaccag
gtgcgggccgacaaggagcgggaagcctcccagggatttgacggcacctgggtggcccac
cccgatctggtgcccgtggcccaggaggtcttcgaccggtacctgggggataagccccac
cagaagcacgtgaagcgggaggacgtccaggtgagggcggaggacctgctgaactttgag
gtcccgggaggcaaggtaacggaggcaggccttcgcaacaacatctccgtggccctccag
tacctgaaccagtggcttctcggcaacggggccgccgccatcttcaacctcatggaggat
gccgccaccgccgagatcagcagggcgcagctctggcaatgggtgcaccggcaggccacc
ttggaggacggccgcacggtcacccctgagctttaccaaaagatcaaggaagaggagctc
gccaagctgggaggacgggaggttggccgctataaggaggccgaggagatcctggacaag
ctggtcctctcggaggagttcatcgagttcctgaccctggtggcctacgattacctggac
tga

DBGET integrated database retrieval system