KEGG   Thermus scotoductus: TSC_c05900Help
Entry
TSC_c05900        CDS       T01414                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tsc  Thermus scotoductus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TSC_c05900 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TSC_c05900 (rocF)
Enzymes [BR:tsc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TSC_c05900 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541398..542381
Genome map
AA seq 327 aa AA seqDB search
MFHPFKYSAKSPFLLGGRHKVPKRCMGFSASMPPMERVAILGVPMDLGAGRRGVDMGPSA
LRYARLAEELEALGLAVEDLGDVRVPVAETLRRKGLRLGGENYLEEIRQAALELKERLRS
LPEGVFPIVLGGDHSLSMGSVSGVAKEPLGVVWVDAHADFNTPETSPSGNIHGMPLAVLC
GLGHPRLTEAFQAVDPKRVVLVGVRSLDPGERRLLREMGVTVYTMHEVDRLGVARIAEEV
LERLAGLPLHVSLDADVLDPTLAPGVGTPVPGGLSYREAHLLMEILAQSGRVRSLDLVEV
NPILDERNRTAEMMVGLASSLLGKRIL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgttccatccttttaagtatagcgccaaaagccccttcctcctagggggtcggcataaa
gttcccaagcggtgcatggggttttctgctagcatgccccccatggagcgggtggccatc
ctgggtgtgcccatggacttaggcgcaggccggcgtggggtggacatggggccttccgct
ttgcgctatgcccggctggcggaggagctcgaggccctgggtctggcggtggaggacctg
ggggacgtgcgggtacccgtggcggaaaccctcaggcgaaagggcttgcgcttgggcggg
gaaaactacctggaggagatccgccaggcggccctcgagctcaaggagcggctccgctcc
ctgccggagggggtatttcccatcgtgctgggcggggaccattccctgagcatgggttcg
gtgagcggggtggccaaggagcccttgggggtggtctgggtggatgcccatgcggacttc
aacaccccggaaaccagcccttcgggaaacattcacggcatgcccctggcggtgctctgc
ggccttgggcacccccgcctcacggaggccttccaggcggtggatcccaagagggtggtc
ctggtgggggtgaggagcctggaccccggggagaggcggcttcttcgggaaatgggggtt
accgtttacaccatgcacgaggtggaccgcctgggggtagcccgcatcgccgaggaggtt
ttggaaaggctcgccggcctgcccctccacgtttccctggacgccgacgtcctggatccc
accctggctcccggggtggggactccggtgcccgggggcctttcctaccgggaggcgcac
cttcttatggagatcctggcccagtcgggccgggtgcggagcctggacctggtggaggtg
aaccccattctggacgagcgtaaccgcaccgcggagatgatggtggggttggcctcgagt
ctcctgggaaagcgtattctttaa

DBGET integrated database retrieval system