KEGG   Thermus scotoductus: TSC_c05900Help
Entry
TSC_c05900        CDS       T01414                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
tsc  Thermus scotoductus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tsc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tsc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
541398..542381
Genome map
AA seq 327 aa AA seqDB search
MFHPFKYSAKSPFLLGGRHKVPKRCMGFSASMPPMERVAILGVPMDLGAGRRGVDMGPSA
LRYARLAEELEALGLAVEDLGDVRVPVAETLRRKGLRLGGENYLEEIRQAALELKERLRS
LPEGVFPIVLGGDHSLSMGSVSGVAKEPLGVVWVDAHADFNTPETSPSGNIHGMPLAVLC
GLGHPRLTEAFQAVDPKRVVLVGVRSLDPGERRLLREMGVTVYTMHEVDRLGVARIAEEV
LERLAGLPLHVSLDADVLDPTLAPGVGTPVPGGLSYREAHLLMEILAQSGRVRSLDLVEV
NPILDERNRTAEMMVGLASSLLGKRIL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgttccatccttttaagtatagcgccaaaagccccttcctcctagggggtcggcataaa
gttcccaagcggtgcatggggttttctgctagcatgccccccatggagcgggtggccatc
ctgggtgtgcccatggacttaggcgcaggccggcgtggggtggacatggggccttccgct
ttgcgctatgcccggctggcggaggagctcgaggccctgggtctggcggtggaggacctg
ggggacgtgcgggtacccgtggcggaaaccctcaggcgaaagggcttgcgcttgggcggg
gaaaactacctggaggagatccgccaggcggccctcgagctcaaggagcggctccgctcc
ctgccggagggggtatttcccatcgtgctgggcggggaccattccctgagcatgggttcg
gtgagcggggtggccaaggagcccttgggggtggtctgggtggatgcccatgcggacttc
aacaccccggaaaccagcccttcgggaaacattcacggcatgcccctggcggtgctctgc
ggccttgggcacccccgcctcacggaggccttccaggcggtggatcccaagagggtggtc
ctggtgggggtgaggagcctggaccccggggagaggcggcttcttcgggaaatgggggtt
accgtttacaccatgcacgaggtggaccgcctgggggtagcccgcatcgccgaggaggtt
ttggaaaggctcgccggcctgcccctccacgtttccctggacgccgacgtcctggatccc
accctggctcccggggtggggactccggtgcccgggggcctttcctaccgggaggcgcac
cttcttatggagatcctggcccagtcgggccgggtgcggagcctggacctggtggaggtg
aaccccattctggacgagcgtaaccgcaccgcggagatgatggtggggttggcctcgagt
ctcctgggaaagcgtattctttaa

DBGET integrated database retrieval system