KEGG   Thermus scotoductus: TSC_c07970Help
Entry
TSC_c07970        CDS       T01414                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tsc  Thermus scotoductus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tsc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tsc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tsc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740852..742366
Genome map
AA seq 504 aa AA seqDB search
MRRRDLLKAGVMTGLAGALMAQAQSAQANRPYLPVRARNLIFLVYDGMGWEDYAIAQFYA
RRVLGRTLALERLLAGPAAWGFQNTNSLTSFVTESSAAGNAWSTGVKTVNGGLAIHADGR
RLTPIFALAKEQGKAVGLVTTATVTHATPASFVISNPDRNAEEQIAEQYLEFGAEVYLGG
GQRFFDPAQRQDKKDMYAAFAARGYGVVRTREELLKSNASKLLGVFSRSHVPYEVDRRFQ
GVDVPSLAEMTRKALQILSARREGFVLQVEAGRVDHANHLNDPAATLWDILAGDEALEVL
LNFVDQNPDTLLLIGADHATGAPALYGTGPSYLLSSAGIELLKEQKASLEFILARLGNQP
TPEAVAELFRTAKGVALTPGEAQAVVAAITQKAYLPDAVVRGVQPANTLSWVMRQTRADQ
VDRPNIGWNSGQHTASPTLLAVYARGVRGGRMGLVDNTYTFTLMTQALGIRFQNPVMSEE
EALEILSKRAAPQGNHPEDALAWV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaagggatctcctcaaggcaggggtaatgacggggttggccggggccctcatg
gcccaggcccaaagcgcccaggcgaaccggccctaccttcccgtaagggcccgcaacctc
atcttcctcgtctacgacgggatgggctgggaggattacgccatcgcccagttctacgcc
cggcgggttctgggccggaccctggccctggagcgcctcctggcgggtccggccgcctgg
gggttccagaacacgaatagcctcacgagcttcgtcacggagtccagcgccgcgggcaac
gcctggagcacgggggtgaagaccgtaaatggggggctggccatccacgcggacgggcgg
aggctcacccccatctttgccctggccaaggagcagggcaaggccgtgggcctggtcacc
accgccaccgtcacccacgccaccccggcaagcttcgtcatctccaaccccgaccgcaac
gcggaggagcaaatcgccgagcagtacctggagttcggggcggaggtctacctcgggggc
gggcagcgcttctttgaccccgcccagcgccaggacaagaaggacatgtacgcggccttc
gccgcccgggggtacggggtggtccgcacccgggaggagctccttaagagcaacgcctcc
aagctccttggggtcttcagccggagccacgtcccctacgaggtggaccgccgtttccaa
ggggtggacgtccctagccttgcggagatgacccgcaaggccctccaaatcctctccgcc
cggcgggaggggttcgtcctccaggtggaggcgggccgggtggaccacgccaaccacctg
aacgaccccgcggccaccctctgggacatcctggcgggggacgaggccttggaggtcctc
ctcaacttcgtggaccaaaaccccgacaccctcctcctcatcggggcggaccacgccacg
ggggcccccgccctttacgggacggggccttcctacctcctaagcagcgcggggattgag
ctcctcaaggagcagaaggcctccttggagttcatcctcgcccggctggggaaccagccc
acccctgaggcggtggccgagctcttccgcacggctaagggggtggccctcaccccaggg
gaggcccaggcggtggtggcggccatcacccagaaggcctacctccccgatgcggtggtc
cgcggggtccagcccgccaacaccctctcctgggtgatgcgccagacccgggccgaccag
gtggaccggcccaacatcggctggaactcgggccagcacacggcttcccccaccctcctt
gcggtgtacgcccggggcgtacggggcgggcggatgggccttgtggacaacacctacacc
ttcaccctcatgacccaggccctgggcatccgcttccagaaccccgtgatgagcgaggag
gaggccctggagatcctttccaagcgggcggccccccaggggaaccatcccgaggacgcc
ctggcctgggtctag

DBGET integrated database retrieval system