KEGG   Thermus scotoductus: TSC_c08040Help
Entry
TSC_c08040        CDS       T01414                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tsc  Thermus scotoductus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TSC_c08040 (malQ)
Enzymes [BR:tsc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TSC_c08040 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749771..751273
Genome map
AA seq 500 aa AA seqDB search
MELPRAYGLLLHPTSLPGPYGVGVLGEEAFAFLRFLGESGARYWQVLPLGPTGYGDSPYQ
SFSAFAGNPYLIDLRPLAEAGYLRLEDPGFPEGRVDYGWLYAWKWPALREAFRGFQERAS
REEKEAFQAFWDRERSWLDDYALFMALKAHHGGLPWNRWPMPLRLREERALREASLALSQ
EVAFHAWTQWFFFRQWQALREAAEALGLSLIGDMPIFVAEDSAEVWAHPEWFHLDEEGRP
TVVAGVPPDYFSETGQRWGNPLYRWEVLEREGFSFWIERLRKALELFHLVRIDHFRGFEA
YWEIPASCPTAVEGRWVKAPGEKLFQKIQETFGRVPILAEDLGVITPEVEALRDRFGLPG
MKVLQFAFDGGMENPFLPHNYPSHGRVVVYTGTHDNDTTLGWYRTATPHERAFLGRYLAE
WGIGFQREEEIPWALMHLGMKSVARLAVYPVQDVLALGSEARMNYPGRPSGNWAWRLRPG
QLLPEHGERLRWMAEATGRV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccgcgcgcctatggcctgcttctgcaccccaccagccttcccggaccctat
ggggttggcgttcttggggaggaggcttttgccttcctccgattcctgggggagtctggg
gcccgctactggcaggttttgcccttagggcccacaggatacggagactccccctaccag
tccttcagcgcctttgccgggaacccctacctcatcgacctccgccctctggcggaggcg
gggtacctccgcctcgaggaccccggttttcccgagggccgggtggattacggctggctc
tacgcctggaagtggccggcgcttagggaagccttccggggtttccaggagcgggctagc
cgggaggaaaaggaggcctttcaggccttttgggaccgggaaaggagctggttggatgac
tacgccctcttcatggccttgaaggcccaccacggaggccttccctggaaccgctggccc
atgcccctacgcctgagggaggaaagggctttaagggaagcatctttggccctctcccaa
gaggtggccttccacgcctggacccagtggtttttcttccggcagtggcaggccctgagg
gaggcggcggaggccttgggcctctccttgatcggcgacatgcccatcttcgtggccgag
gactccgcggaggtctgggcccaccccgagtggttccacctggatgaggagggaaggccc
acggtggtggcgggggtgccgccggattacttttcggaaacgggccagcgctgggggaat
cccctgtaccgctgggaggtgctggaaagggaggggttctccttctggatagagcgcctg
aggaaggccttggagcttttccacctggtgcgcatcgaccacttccggggctttgaagcc
tactgggagatccctgcctcctgccccacggcagtggagggacgctgggtgaaggccccg
ggggagaagctctttcagaagattcaggaaacctttggccgggtgcccatcctggcggag
gacctgggggtgatcacccccgaggtggaggccctgagggaccggtttggccttccgggg
atgaaggtcctgcagttcgcctttgacggggggatggaaaaccccttcctgccccacaac
tacccctcccacggccgggtggtggtctacaccggcacccacgacaacgacaccaccctg
ggctggtaccgcaccgctaccccccacgagcgggctttccttgggcgctacctggcggag
tgggggattgggttccagagggaagaggagatcccctgggccctcatgcacctggggatg
aagtcggtggccaggctggccgtctaccccgtgcaggatgtgttggcgttgggaagcgag
gcccggatgaactaccctgggcgcccctcgggcaactgggcttggcggcttaggcccggc
cagctcctgcccgagcacggggaacggcttcgctggatggccgaggccacgggcagggtg
tga

DBGET integrated database retrieval system