KEGG   Thermus scotoductus: TSC_c08060Help
Entry
TSC_c08060        CDS       T01414                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tsc  Thermus scotoductus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c08060
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TSC_c08060
   00640 Propanoate metabolism
    TSC_c08060
   00660 C5-Branched dibasic acid metabolism
    TSC_c08060
Enzymes [BR:tsc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TSC_c08060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752182..753318)
Genome map
AA seq 378 aa AA seqDB search
MNLHEYQAKEILARYGVPVPPGKVAYTPDEAKRIAEELGKRVVIKAQVHVGGRGKAGGVK
LADTPQEAYEKAQAILGMNIKGLTVKKVLVAEAVDIAKEYYAGLILDRAQKRVVLMLSKE
GGVDIEEVAAERPEAIHKFWIDPHKGFRAFEAREMVKQAGLEGNLNKLAQVLVALYQAYE
GVDASIAEINPLVVTTDGQIVAADAKIVLDDNALFRHPELMELREIEAEHPLEVEASNYG
FAYVKLQGNIGIIGNGAGLVMYTLDLVNRVGGRPANFLDIGGGAKAEVVYNALKVVLKDP
DVKGVFINIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEEAKRLLEGRPIYMY
PTSIEAAKAIVAMVGGAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgaacctgcacgagtatcaagccaaggagatcctggcccgttatggggtaccggtgccg
cccggcaaggtggcctacacccccgacgaggccaaaaggatcgcggaggagctgggcaag
cgggtggtgatcaaggcccaggtgcacgtgggcgggagaggtaaggccgggggcgtgaag
ctggcggacaccccccaggaagcctacgagaaggcccaggccatcctggggatgaacatc
aagggcctcacggtgaagaaggtcctggtggccgaggcggtggacatcgccaaggagtac
tacgccggcctcatcctggaccgcgcccaaaaacgggtggtcctcatgctctccaaggaa
gggggggtggacatcgaggaagtggcggcggagcgccccgaggccatccacaagttctgg
atcgacccccacaagggctttcgggcttttgaggcccgggagatggtgaaacaagcgggc
ctcgagggcaacctcaacaagctggcccaggtgctggtggccctctaccaggcctacgag
ggcgtggatgcctccatcgccgagatcaaccccctggtggtcaccaccgacggccagatc
gtggccgccgacgccaagatcgtcctggacgataacgccctcttccggcaccccgagctg
atggagctgagggagatcgaggccgagcatcccctggaggtggaggccagcaactacggc
ttcgcctacgtgaagcttcaggggaacatcggcatcatcggcaacggggccggcctggtc
atgtacaccctggacctggtgaaccgggtgggcggcagacccgccaacttcctggacatc
gggggcggggccaaggcggaggtggtctacaacgccctcaaggtggtccttaaggacccc
gacgtaaagggggtgttcatcaacatcttcggcggcatcacccgggcggacgaggtggcc
aagggggtgatccgggccctggaggaggggcttctcaccaagcccgtggtcatgcgggtg
gcgggaaccgccgaggaagaggccaaaaggctcctggagggcaggcccatctacatgtac
cccacgtccatcgaggcggccaaggccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system