KEGG   Thermus scotoductus: TSC_c08660Help
Entry
TSC_c08660        CDS       T01414                                 

Gene name
acs3
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tsc  Thermus scotoductus
Pathway
tsc00010  Glycolysis / Gluconeogenesis
tsc00620  Pyruvate metabolism
tsc00640  Propanoate metabolism
tsc00680  Methane metabolism
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01130  Biosynthesis of antibiotics
tsc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c08660 (acs3)
   00620 Pyruvate metabolism
    TSC_c08660 (acs3)
   00640 Propanoate metabolism
    TSC_c08660 (acs3)
  Energy metabolism
   00680 Methane metabolism
    TSC_c08660 (acs3)
Enzymes [BR:tsc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TSC_c08660 (acs3)
Lipid biosynthesis proteins [BR:tsc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TSC_c08660 (acs3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADW21491
UniProt: E8PNL6
Position
complement(814785..816683)
Genome map
AA seq 632 aa AA seqDB search
MEPIWYPKPEEIQATRLFRFMEALGFRDYEAFYRYSVEELEAFYHQFFTHLGLPWRKPYE
RVIEGGFPLPRFFVGGRLNLVEAALSHEPTALALIHETEEGTVRALTYGKLLQEVERVAA
GLRALGVERGDRVGLWFPMGLEAAILLLATAWLGAIAIPIFSGYAAEAAAVRLKDAKAKL
LAVQDGFHRRGRRVELLLEARKAQALAETPHLLVVRRLGLPLEAGELDYASLRGEPFPAE
EMESMDPFMLIYTSGTTGRPKGTVHYHAGFPLKAALDLALLFDLREGDRLFWFTDLGWMM
GPWAILGGLILGATVFLYDGAPDYPGPERLWRMVEAHRLTHLGLSPTLVRALIPLGEEPI
RAHDLSSLRVLGSTGEPWNLEPYLWFFRAVGEEKRPIVNYSGGTEVSGGILGNVLVKPIK
PMGFNTAVPGMAAAVLDPEGKPVVGQVGELAVLRPWPGMTKGFWQDEARYLDTYFSRVPG
VWVHGDLALQDEEGHFFILGRSDDTLKVAGKRVGPAEVETAATRHPALKECAAIGVPHPV
KGEAIVLFAVLKPGFSPSPELAQAVADRVAEALGKPLKPERVLFVPDLPKTRNAKVMRRV
IRAAFLGQDPGDLSALENPEAVEAIRQASRES
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaacccatctggtaccccaagccggaggagatccaggccaccaggctcttccgattc
atggaggccctgggtttccgggactacgaggctttctaccgctatagcgtggaggaactt
gaggctttttaccaccagtttttcacccacctgggcctaccctggcgcaaaccctacgag
cgggtcatagaaggtgggtttccccttccccgcttcttcgtgggggggcggcttaacctg
gtggaggcagccctcagccacgagcccaccgccttagccctcatccacgaaaccgaggag
ggaacggtgcgcgccctcacctacgggaagcttttgcaggaggtggaaagggtggcggca
gggcttcgggccctgggggtggagcgaggggaccgggtgggcttgtggttccccatgggc
ctcgaggcggccattctcctcctggccaccgcctggcttggggccatcgccattcccatc
ttctccggctacgccgccgaggcggcggcggtgcggctcaaggacgccaaggccaagctt
ttggcggtgcaggatggcttccaccgccggggaagaagggtggagctcctcctcgaggcc
cgcaaggcccaggccctggcggagaccccccatctcttggtggtgcgccggctgggcctg
cccctggaggccggggaactggactacgcatccttaaggggcgagcccttccccgcggag
gagatggagagcatggaccccttcatgctcatctacacctccggcaccacgggccggccc
aagggaaccgtccactaccatgcgggctttcccctcaaggccgcccttgacctggccctt
ctctttgacctgagagaaggggatcgcctcttctggttcacggacctgggctggatgatg
gggccctgggccatcctgggagggctgatcctgggggccacggtgttcctctacgacggc
gcccccgactacccgggaccggagcggctttggcgaatggtggaggcccaccgcctcacc
cacctgggcctctcccccaccctggtgcgggccttgatccctttgggggaggagcctatc
cgggcccacgacctcagctcccttcgggtcctcggctccaccggggagccctggaacctc
gagccctacctctggttcttccgggcggtgggggaggaaaagaggcccatcgtgaactac
tcgggagggacggaggtttccggaggcatcctgggcaatgttctggtcaaacccatcaag
cccatgggcttcaacaccgccgtgcccgggatggccgcggcggtgctggacccggagggg
aaacccgtggtgggccaggtgggggagcttgcggtgctcaggccgtggcccggaatgacc
aagggattctggcaggacgaggcccgctacctggacacctatttctcccgtgtccccggg
gtttgggttcacggggatctggccctacaggatgaggaaggccacttcttcatcctgggc
cgaagcgacgacacccttaaggtggcgggcaagcgggtggggcctgccgaggtggaaacc
gccgccacccgccaccccgccctcaaggaatgcgccgccatcggggtgccccacccggtg
aagggggaggccatcgtgctcttcgccgtgctgaagcccggcttctcccctagccccgag
ctggcccaggcggtggccgaccgggtggcggaagccctgggcaaacccttaaagccggaa
agggttctctttgtccccgacctgcccaagacccgaaacgccaaggtgatgcgccgggtg
atccgggccgccttcctgggccaggaccccggggatctctcggccctggagaaccccgag
gcggtggaggccatccgccaggcctcccgggaaagctag

DBGET integrated database retrieval system