KEGG   Thermus scotoductus: TSC_c09010Help
Entry
TSC_c09010        CDS       T01414                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tsc  Thermus scotoductus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TSC_c09010
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    TSC_c09010
Enzymes [BR:tsc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     TSC_c09010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(852935..853684)
Genome map
AA seq 249 aa AA seqDB search
MENTKTVLITGAASGIGLALTRAFAQEGARVLVHDLQDASALAKELGGIFLQADLADPKA
VEELGKQAAQYGVDILVNNAGFQHIDPVEEFPLETWQRMIQVMLTAPFQLIKALLPGMKA
KGWGRILNIASIHGLVASPYKSAYISAKHGLLGLTKTVALEAGPYGITVNAIAPAYVRTP
LVENQIADQARTLSLPESEVVEKVFLAQAAIKRLIEPEEVVALALFLASEKAAAITGAVF
PIDLGWTAR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaccaaaaccgtgctgatcaccggtgcagcaagcggcatcggtctagccctg
acccgggccttcgcccaggagggagccagggtcctggtccacgatctccaagatgcctcg
gccttggctaaggagctcggcgggatcttcctgcaggcggacctggccgatcccaaagcc
gtggaggaactcgggaagcaagcggcccagtacggcgtggacatcctggtgaacaacgca
ggcttccagcacatcgacccggtggaggagtttcccctggaaacctggcaaaggatgatc
caggtgatgctcaccgcccctttccagctcatcaaggcccttctcccgggaatgaaggcc
aagggctgggggcggatcctcaacatcgccagcatccacggcctggtggccagcccctac
aagtccgcctacatctccgccaagcacggcctcttgggcctcaccaagaccgtggccctc
gaggcaggtccctatggcatcaccgtgaacgccatcgcccccgcctacgtgcgcaccccc
ctggtggagaaccagattgccgaccaagcccgcaccctttccctccctgaaagcgaggtg
gtggaaaaggtcttcctagcccaagcggccatcaagcgcctcatcgaacccgaggaggtg
gtggccttggccctcttcctggcctcggaaaaggccgcggccatcaccggggccgtcttc
cccatcgacctgggctggaccgcccgctag

DBGET integrated database retrieval system