KEGG   Thermus scotoductus: TSC_c10830Help
Entry
TSC_c10830        CDS       T01414                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tsc  Thermus scotoductus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TSC_c10830
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TSC_c10830
Enzymes [BR:tsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TSC_c10830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1029588..1031099
Genome map
AA seq 503 aa AA seqDB search
MRLLAILAGMGMAAAQAGNFLIVSFKGEEVPVALLKEIRPAGVILYPSNLRRDPQGVVAR
LRALDPKLLLLVDQEGGPFTSYREGVVRFPSAMALSASGDEGLVERVGWALGCQVRRLGA
DVNLAPVLDVNTNPDNPIIGLRSFGADPERVARMGLAFARGVLRSGAKPVGKHFPGHGDT
GVDSHLDLPRVDKPKEALEGAELLPFRRYVAAGMPALMTAHILFPALDPKYPATLSAKIL
TGLLRREMGFTGAILTDDMAMGAIKRHYGAGEAAVLAVKAGADLLLLEPDEAAIREVHAR
LSQALGQEIPLSRAEEARRRAQGLKAGQGECPFTPKEEEALALEAARRGVVHRFGPLPIP
GQGTLVLGLRISDRYGAEPTLADLAPQYLPGSRGLILSEDPTPVEIQKALAEARKAERLV
ASTYRWLGGFKEGQRTLVKELLALGKPLYLVALGNPDDLRFLPGKPTGYLATHGYRAVQV
RAALEALAGVYAPTGQWVFGGEP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcttttggccatcctggcgggaatgggcatggcggcggcccaggcgggaaacttt
ctcatcgtgagcttcaagggggaagaggtgccggtggcccttctcaaggagatccgtccc
gccggggtcatcctttacccctccaacctccgccgggatccccagggggtggtggcccgt
ctcagggccttggatcccaagcttcttctcctggtggaccaggaggggggaccctttacc
tcctaccgggagggggtggtgcgcttcccctcggccatggccctttccgccagcggggat
gagggcctggtggagcgggtgggctgggccctggggtgccaggtgcggcggcttggggcg
gatgtgaacctggcgccggttctggacgtgaacaccaaccccgacaaccccatcattggc
ctccgctccttcggcgccgaccccgagcgggtggcccgcatgggcctggcctttgcccgg
ggggttttgcgctccggggcgaagcccgtgggcaagcacttccccgggcatggggacacg
ggggtggactcccacctggacctgccccgggtggataagcccaaggaggccctggaggga
gcggagctccttcccttccgccgctatgtggccgcggggatgccggccctcatgaccgcc
cacatcctctttcccgccttggatcccaaataccccgccaccctttcggccaaaatcctc
acaggcttgctccggagggagatgggctttaccggggccatccttaccgatgacatggct
atgggggccatcaagcgccactacggggcgggggaggcggcggttctggccgtgaaggcc
ggggccgatttgctcctgctggaacccgatgaggcggccatccgggaggtgcacgcccgg
ctctcccaggccctgggccaggagattcccctttcccgggcggaggaggccagaaggcgg
gcccagggccttaaggcaggccagggggaatgccctttcaccccgaaggaggaggaggct
ttggccctcgaggcggcccggcggggcgtggtgcaccgctttggccccctgcccataccc
ggtcagggaaccttggtcttgggcctgaggatctctgaccgctacggagcggagcccacc
ctggcggaccttgccccccagtaccttcccggaagccgggggctcatcctttcggaggat
cccaccccggtggagatccagaaggccttggcggaggccaggaaggcggagcgcctggtg
gcctccacctaccgctggcttggcggtttcaaggaggggcaaaggaccttggtgaaggag
ctcctggccctgggcaaacccctatacctggtggccttgggcaaccccgacgaccttcgc
ttccttccagggaagcccacgggctatctggctacccacggctaccgcgcggtccaggtc
cgggccgcgttggaggccctcgcaggggtgtatgcccctacggggcaatgggtctttgga
ggtgaaccatga

DBGET integrated database retrieval system