KEGG   Thermus scotoductus: TSC_c11240Help
Entry
TSC_c11240        CDS       T01414                                 

Gene name
cga
Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
tsc  Thermus scotoductus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TSC_c11240 (cga)
Enzymes [BR:tsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TSC_c11240 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067466..1069736
Genome map
AA seq 756 aa AA seqDB search
MEAFGKPGIPPTWASSAKDWIGTALGRSRVWYTLGRGILNEVYWPATGRPQMRDLGFIVA
KRGFWAEVKRVNRYRLEATPLFPTVRVVHEGEEYRLTLELVPDPQRDVLLIGYTLEGEGF
RLYPLLAPHLGGTGYGNTAWVKEGALLAAKGSEALALLGPFLRGSAGYVGFSDGWQDFAQ
NGAMTWTFARATDGNVALMGELEGKKGVMALAFATTPEGALTLGRSALGEGIETIQEKAS
ATWSEIASPQFPGEDEELLREAQVSYHVLKVHEDRTYPGALVASLSVPWGNTRDDPGGYH
LVWSRDLVEVAFAYLALGQFAETRGILTYLAAVQAEDGHWAQNFYPDGRAYWQGVQMDEA
ALPVLLALKFRELGQLSPNGALRQMVRRAVGFLAREGPVSPQDRWEESPGLSPFTLAVSV
AALSGAALYGFLQGEEAEYALSLADCWNARIEEWCYVKGSGLDRAVGVEGHYVRLSPSGP
LGPRGRVQVANRAGVAVDVAELLGLEFLWLVRLGLRRPQDPRIVSTLALVDRHLRVDLPT
GIFYRRYPEDGYGEHGDGSAFDGTGQGRAWPLLTGERGMYALLSGEDPCPYLRSMARGTG
RGRLIPEQVWDADPIPEKGLLPGRPTGSAQPLLWAHAEYLKLYTAYHQRTGPVERLGRVM
ERYERGSSPQVRHWRREVPVLRLSPTERLLVECRKPFRLHLGWEGWKDPEDVEAEPLPFG
LYGVLLDLEDHSEVNFTFFYPDENRWEGRDYQVRRG
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctttggcaagccggggattccgcccacctgggccagcagcgcaaaggactgg
ataggcacggcccttgggagaagccgggtctggtacaccctgggccgcgggatcctcaac
gaggtttactggcccgccaccggccgtccccagatgcgggacctgggcttcatcgtggcg
aaaagggggttctgggcggaggtgaagcgggttaaccgctatcgcctcgaggccacgccc
ctcttccccacggtgcgcgtggtacacgagggcgaggagtaccgccttaccctggaactg
gtccccgatccccaacgggatgtcctgctgatcggttataccctggagggggaaggcttt
cgcctgtatcccctcctcgctccccaccttgggggaacgggttatgggaacaccgcctgg
gtgaaggagggcgcacttctggcggccaagggatccgaggccctagccctcctgggcccg
ttccttaggggaagcgcaggttatgtgggtttctcggatggctggcaagattttgcccaa
aacggggctatgacctggacctttgccagggccacggatggcaacgtggccctcatgggt
gagctggagggaaagaagggcgttatggccttggccttcgccactaccccggagggggcc
ctcaccctagggcggtctgccctgggggaaggtatagaaacaatccaggaaaaagcctct
gccacctggagcgagatagcctcaccccagtttcccggagaggatgaggaactcttacgg
gaggcacaggtttcctaccacgtcctcaaggtgcacgaggaccgcacctaccccggggcc
ttggtggcgagcctgtccgtgccctggggcaatacccgggacgaccctgggggctaccat
ctggtttggagccgggacctggtggaggtggccttcgcctacctggcccttgggcagttc
gccgagactcgagggatcctcacctacctggcggctgttcaggccgaggatggccactgg
gcgcagaatttttacccggatggccgggcctactggcagggcgtgcaaatggatgaagcc
gctttgcccgtccttctggccctaaagtttagggagttggggcaactttccccaaacggc
gctctccgccagatggtacggcgggcagtgggctttctggcccgggagggtccggtgagc
ccccaggaccgctgggaggaaagccctggcctttccccctttaccttggccgtaagcgtt
gccgccctgtctggggctgccttatacggctttttgcagggggaggaggcggagtatgcg
ctttcccttgcggactgttggaatgcgcgcattgaggaatggtgctacgtgaagggttcg
gggctggaccgggcggtaggtgtggagggccattatgttcgcttatccccttcgggtccc
ctgggtcccaggggtcgggttcaggtggccaaccgagctggtgtggccgtggatgtggcg
gagcttctgggcctggagtttttgtggctggtgcgcctgggtctgcgacgtccccaagac
cctcgcatcgtttctaccctggccctggtggacaggcatcttcgggtggatcttcccacc
ggcattttctaccgtcgctacccggaggatggatacggggagcatggggatggaagcgcc
tttgacggcactggccagggccgggcctggccccttcttaccggggagcggggaatgtac
gcactactttccggggaagacccgtgcccctacctaaggagcatggcccgggggaccggg
cgtggtaggctcatccctgagcaggtatgggatgcggatcctatccctgaaaaggggctt
cttccgggccgccctaccggtagcgcccaacctcttctttgggcccatgcggagtacttg
aagctctacacggcctatcaccaacggaccggtcccgtggagcgcctaggacgggtgatg
gagcgctacgagcgggggtcgtcgccgcaggtgcgccattggcggcgggaggtccccgtt
cttcgcctttcccccacggaacgccttctggtggagtgccgcaagcctttccggctccac
ttgggctgggagggatggaaggatcctgaggatgtagaggcggaacccctgccgtttggg
ctctacggggttcttttggacctcgaggatcattccgaggtaaacttcaccttcttttac
ccggacgagaaccgctgggaaggaagggactaccaagtgcggaggggttag

DBGET integrated database retrieval system