KEGG   Thermus scotoductus: TSC_c11560Help
Entry
TSC_c11560        CDS       T01414                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tsc  Thermus scotoductus
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TSC_c11560
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSC_c11560
   00650 Butanoate metabolism
    TSC_c11560
  Amino acid metabolism
   00360 Phenylalanine metabolism
    TSC_c11560
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TSC_c11560
   00622 Xylene degradation
    TSC_c11560
   00621 Dioxin degradation
    TSC_c11560
Enzymes [BR:tsc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TSC_c11560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097775..1098695
Genome map
AA seq 306 aa AA seqDB search
MDKVKVAILGSGNIGTDLMYKLLKNPGHMELVALVGIDPKSEGLARAKALGLEASHEGIT
YIVERPEIRIVFDATSAKAHVRHAKLLREAGKIAIDLTPAARGPYVVPPVNLKEHLDKDN
VNLITCGGQATIPLVYAVHRVAPVLYAEMVSTVASPSAGPGTRQNIDEFTFTTAKGLEAI
GGAQIGKAIIILNPADPPIIMTNTVRAIPHDEGFDRDAVVASVRAMEAEVQAYVPGYRLK
ADPVFERLPTPWGERTVISMLLEVEGAGDFLPKYAGNLDIMTASARRVGEVFAQYLLGAR
VEEVVA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtcaaagtggcgatcctaggttccggaaacattgggacggacctgatgtat
aagcttctcaaaaacccagggcacatggaactggtcgccctggtgggaatcgatcctaaa
tcggagggcctggcccgggctaaggcgttgggcctcgaggccagccacgagggaatcaca
tacatcgtggagaggccggaaatccgtatcgtttttgacgccaccagcgccaaagctcac
gtgcgccacgctaagctgctaagggaagcggggaaaattgccatcgaccttacccctgcg
gcccggggcccctatgtggtgccccctgtcaacctgaaggaacacttggacaaggataat
gtcaacctcattacctgcggcgggcaggccacgattcccctggtttatgcggtgcatcgg
gtggctccggtgctctatgcggagatggtgtccaccgtggcctcgccttccgcaggccca
ggaacgcgccagaacattgacgagttcacctttaccacggcgaagggattggaggcgata
gggggcgcccagatagggaaggccatcatcatccttaacccggcggatcctcccatcatc
atgaccaacaccgttcgggctattccccacgacgagggttttgaccgggatgcggtggtg
gccagcgtgcgagccatggaggccgaggtgcaggcctacgtgccgggttatcgtctgaag
gcggaccctgtttttgaacgcctccccacgccctggggggagaggaccgtgatctccatg
cttttagaggtagaaggagcgggagacttcctgcccaaatacgctgggaatctggatatc
atgaccgcctcggcccggagggtgggcgaggtttttgcccagtacctcctgggggcgcgg
gtggaggaggtggtggcgtga

DBGET integrated database retrieval system