KEGG   Thermus scotoductus: TSC_c11920Help
Entry
TSC_c11920        CDS       T01414                                 

Definition
dihydroorotate dehydrogenase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tsc  Thermus scotoductus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c11920
   01230 Biosynthesis of amino acids
    TSC_c11920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c11920
   00030 Pentose phosphate pathway
    TSC_c11920
   00051 Fructose and mannose metabolism
    TSC_c11920
  Energy metabolism
   00680 Methane metabolism
    TSC_c11920
Enzymes [BR:tsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TSC_c11920
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TSC_c11920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1130165..1131256
Genome map
AA seq 363 aa AA seqDB search
MKITLSVLKADIGSVGGHTLPSRRVLAKVEEVVREEVGRLLLDAHVFHIGDDIVLLLSHT
HGIRNASVHELAWKAFREGTQVAKEEGLYGAGQDLLKDAFSGNLHGLGPQVAEMEFEERP
AEPFMVLAADKTEPGAFNLPLYLVFADPMYSSGLLLSSELRPGFRFRIMDLAQTERDSYV
VLDAPERLYDIAALLRDSHRFGIESIWSRRYGEIAAVVSTTRLRNIAGRYVGKDDPVAII
RTQKIFPATEEFGPPFALAPFVAGDTRGSHHLPLMPVKANTAASTFFCVPMVCGLAFSLK
EGRFSEPVDLFADPVWDTVRAKVVEKAQEMRRQGFYGPAMLPMEELEYTGIAERLKELER
EFS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacccttagcgtcctcaaggccgacatcggttctgtcggaggccacacctta
cccagccgcagggtgctggccaaggtggaggaggtggtacgggaggaggtgggccgcctg
ctcttggacgcccacgtgttccacatcggggacgacatcgtcctcctcctgtcgcatacc
cacggcattcgaaacgcatccgtccacgagctggcctggaaagccttccgggaaggtacc
caggtggccaaggaggagggtctttacggggccgggcaggatcttttgaaggatgccttc
tccggtaacctccacggcctggggccccaggtggcggagatggaattcgaggagcgcccc
gccgagcccttcatggtcctggccgccgataagaccgagcccggggccttcaacctgccc
ctatacctggtcttcgccgaccccatgtactcctctggtctcctcctctcctcggagttg
cgccccggtttccgctttcgcatcatggacctagcccagacggagagggatagctacgtt
gttttggatgctcccgaaaggctttatgacatagctgccctacttagggattcccaccgc
ttcgggatagagtccatctggtccaggcgctacggggaaattgctgcggtggtgagcacc
acgcgcttgcggaacatcgccgggcgctatgtgggtaaggacgatcccgtggccatcatc
cgcacccagaagatctttccagcaacggaggagttcggcccaccctttgccctggcgccc
ttcgtggccggggatacccggggaagccaccacctgcccctcatgcccgttaaggccaac
accgccgcttccacctttttctgcgtacccatggtgtgcgggctggccttctccctcaag
gagggccggttctctgagcctgtggatctctttgcggatccggtgtgggatacggtgcgg
gccaaggtggtggagaaggcgcaggaaatgcgccgtcagggattttacggcccggccatg
ctgcccatggaggagctggagtatacgggcattgccgagcggcttaaggagcttgaacgg
gagttctcctag

DBGET integrated database retrieval system