KEGG   Thermus scotoductus: TSC_c13600Help
Entry
TSC_c13600        CDS       T01414                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsc  Thermus scotoductus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c13600 (tpiA)
   01230 Biosynthesis of amino acids
    TSC_c13600 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c13600 (tpiA)
   00051 Fructose and mannose metabolism
    TSC_c13600 (tpiA)
   00562 Inositol phosphate metabolism
    TSC_c13600 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TSC_c13600 (tpiA)
Enzymes [BR:tsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TSC_c13600 (tpiA)
Exosome [BR:tsc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TSC_c13600 (tpiA)
  Exosomal proteins of bladder cancer cells
   TSC_c13600 (tpiA)
  Exosomal proteins of melanoma cells
   TSC_c13600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1310430..1311182)
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKVPSEARVWLAELRRLLPPLESEVAVLPAFPMLPVAREVLSGAQVAY
GAQDVSPHREGAYTGEVSARMLSDLGCRYTIVGHSERRRYHHETDTLVAEKAKRLLEEGV
TPILCVGEPLEVRERGEAVPYTLAQLRGSLEGLNPPGPEALVIAYEPVWAIGTGRNATPQ
DAEAMHQAIRQALAERYGPGFAQRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLRIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggttttggtggcaggaaactggaagatgcacaaggtgccctcggaggctagg
gtctggcttgccgagctcaggaggcttctgcctcctttagagtccgaggtggcggtgctg
cctgcctttcccatgcttcccgtggccagggaggtgctttccggtgcccaggtggcctac
ggggcccaggatgtctccccccaccgggaaggcgcctatacgggggaggtttccgcccgg
atgctttccgatctcgggtgccgctacaccatcgtggggcactcggagaggcggcgctac
caccacgagacggataccctggtggcggagaaggcgaaaaggcttttggaggagggggtt
acccccatcctttgcgtgggggaacccttggaggtgagggaaaggggagaggcggtgccc
tataccctggcccagctaaggggaagcctcgagggcctgaaccccccgggtcctgaggcc
ttggtgattgcctacgagccggtctgggccatcggcaccgggcggaacgccaccccacag
gacgccgaggccatgcaccaggccatccgccaggccctggcggagcggtacggcccgggg
tttgcccagcgggtgcgcatcctctatggggggagcgtgaaccccaagaacttcgccgac
ctcctctccatgcccaacgtggacggggggctcgtgggcggggcgagcctggagcttgaa
agcttcctcgccctcctccggatcgcgggttag

DBGET integrated database retrieval system