KEGG   Thermus scotoductus: TSC_c13600Help
Entry
TSC_c13600        CDS       T01414                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsc  Thermus scotoductus
Pathway
tsc00010  Glycolysis / Gluconeogenesis
tsc00051  Fructose and mannose metabolism
tsc00562  Inositol phosphate metabolism
tsc00710  Carbon fixation in photosynthetic organisms
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01130  Biosynthesis of antibiotics
tsc01200  Carbon metabolism
tsc01230  Biosynthesis of amino acids
Module
tsc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsc_M00002  Glycolysis, core module involving three-carbon compounds
tsc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c13600 (tpiA)
   00051 Fructose and mannose metabolism
    TSC_c13600 (tpiA)
   00562 Inositol phosphate metabolism
    TSC_c13600 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TSC_c13600 (tpiA)
Enzymes [BR:tsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TSC_c13600 (tpiA)
Exosome [BR:tsc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TSC_c13600 (tpiA)
  Exosomal proteins of bladder cancer cells
   TSC_c13600 (tpiA)
  Exosomal proteins of melanoma cells
   TSC_c13600 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADW21979
UniProt: E8PJM4
Position
complement(1310430..1311182)
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKVPSEARVWLAELRRLLPPLESEVAVLPAFPMLPVAREVLSGAQVAY
GAQDVSPHREGAYTGEVSARMLSDLGCRYTIVGHSERRRYHHETDTLVAEKAKRLLEEGV
TPILCVGEPLEVRERGEAVPYTLAQLRGSLEGLNPPGPEALVIAYEPVWAIGTGRNATPQ
DAEAMHQAIRQALAERYGPGFAQRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLRIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggttttggtggcaggaaactggaagatgcacaaggtgccctcggaggctagg
gtctggcttgccgagctcaggaggcttctgcctcctttagagtccgaggtggcggtgctg
cctgcctttcccatgcttcccgtggccagggaggtgctttccggtgcccaggtggcctac
ggggcccaggatgtctccccccaccgggaaggcgcctatacgggggaggtttccgcccgg
atgctttccgatctcgggtgccgctacaccatcgtggggcactcggagaggcggcgctac
caccacgagacggataccctggtggcggagaaggcgaaaaggcttttggaggagggggtt
acccccatcctttgcgtgggggaacccttggaggtgagggaaaggggagaggcggtgccc
tataccctggcccagctaaggggaagcctcgagggcctgaaccccccgggtcctgaggcc
ttggtgattgcctacgagccggtctgggccatcggcaccgggcggaacgccaccccacag
gacgccgaggccatgcaccaggccatccgccaggccctggcggagcggtacggcccgggg
tttgcccagcgggtgcgcatcctctatggggggagcgtgaaccccaagaacttcgccgac
ctcctctccatgcccaacgtggacggggggctcgtgggcggggcgagcctggagcttgaa
agcttcctcgccctcctccggatcgcgggttag

DBGET integrated database retrieval system