KEGG   Thermus scotoductus: TSC_c16620Help
Entry
TSC_c16620        CDS       T01414                                 

Definition
hypothetical protein
Organism
tsc  Thermus scotoductus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1581811..1582305)
Genome map
AA seq 164 aa AA seqDB search
MRDRIVKGLVLGVGIVFAGLLWAVLEYKGAGEVTVSPVMHAHAWPKREKPYVLLFYDPLC
PVCQKLEGDLEGDGELRAYVRYLPAFLHQGSYEAWLSLLLRWGWDEAEARAWLELLKPEV
EASGLTMTPTAYVADAVGRGKVIVGYPGYERWRQEVLSALGVGR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagggatcggatcgtcaaggggttagtcttgggagttgggatcgtcttcgccgggttg
ctctgggcggtcctggaatacaaaggggcgggggaggtcacggtctccccggtcatgcac
gcccacgcgtggccgaaacgggagaagccgtatgtccttctcttctacgaccctctgtgc
cctgtttgccagaagctcgaaggcgacctcgagggggatggggagctaagggcgtatgtt
cgctaccttcccgcctttctgcaccagggctcttacgaggcctggctttccctcctccta
aggtggggatgggacgaggcggaagcccgcgcctggcttgagctcttgaagccggaagta
gaggcttccggtctcaccatgactcccacggcctatgtggcggacgcggtggggagggga
aaggtcatcgtgggttatccgggctacgagagatggcgacaggaggtcctgagtgccctc
ggtgttggccgttga

DBGET integrated database retrieval system