KEGG   Thermus scotoductus: TSC_c16620Help
Entry
TSC_c16620        CDS       T01414                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tsc  Thermus scotoductus
Brite
Enzymes [BR:tsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TSC_c16620
Secretion system [BR:tsc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   TSC_c16620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1581811..1582305)
Genome map
AA seq 164 aa AA seqDB search
MRDRIVKGLVLGVGIVFAGLLWAVLEYKGAGEVTVSPVMHAHAWPKREKPYVLLFYDPLC
PVCQKLEGDLEGDGELRAYVRYLPAFLHQGSYEAWLSLLLRWGWDEAEARAWLELLKPEV
EASGLTMTPTAYVADAVGRGKVIVGYPGYERWRQEVLSALGVGR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagggatcggatcgtcaaggggttagtcttgggagttgggatcgtcttcgccgggttg
ctctgggcggtcctggaatacaaaggggcgggggaggtcacggtctccccggtcatgcac
gcccacgcgtggccgaaacgggagaagccgtatgtccttctcttctacgaccctctgtgc
cctgtttgccagaagctcgaaggcgacctcgagggggatggggagctaagggcgtatgtt
cgctaccttcccgcctttctgcaccagggctcttacgaggcctggctttccctcctccta
aggtggggatgggacgaggcggaagcccgcgcctggcttgagctcttgaagccggaagta
gaggcttccggtctcaccatgactcccacggcctatgtggcggacgcggtggggagggga
aaggtcatcgtgggttatccgggctacgagagatggcgacaggaggtcctgagtgccctc
ggtgttggccgttga

DBGET integrated database retrieval system