KEGG   Thermus scotoductus: TSC_c17580Help
Entry
TSC_c17580        CDS       T01414                                 

Definition
nitrite reductase (EC:1.7.2.1 1.7.99.1)
Orthology
K15864  
nitrite reductase (NO-forming) / hydroxylamine reductase [EC:1.7.2.1 1.7.99.1]
Organism
tsc  Thermus scotoductus
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    TSC_c17580
Enzymes [BR:tsc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.1  nitrite reductase (NO-forming)
     TSC_c17580
   1.7.99  With other acceptors
    1.7.99.1  hydroxylamine reductase
     TSC_c17580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1668320..1669930)
Genome map
AA seq 536 aa AA seqDB search
MKRTLGLLGSLLLAALALAQAPAPLSPAEKEEAAKIYFDRCAGCHGVLRKGATGPALDPK
KMAEKGVEYLKAVIFGGLPGGMPDWGRQGILKEKDIELVARFLLEQPPAPPVPTFEEIKK
TWKVHVPPEKRPTKPLHNRNWQNFFGQVLRDTGQVAIIDGDKKELVSIVPTGFATHILRS
SATGRYFMAIGRDGKASLIDLWMNPPQVVAESKPCLDARSIESSKFKGYEDKYAVVGCYW
PPTMVVLDGLTLEPLKMVSTISYAKGAGELVMEARVAAIVASHFNPEWIVNLKESGQTWL
VDYSNLHKKGRPLPITMIDTNLFLHDGGWALKRYFIVAANALNKLIVIDTKTREFAAEVE
AGVRPHPGRGSNWEHPTYGPVWATGNIGSPEVTVVGVDPEKHPQYAWKVVKRITLPYTGN
LFIKTHPNSPWVIVDFPMSPSPQAAASLCAIDKRKLEVAKCWEVPGAQELKARMVHPEFN
KGGTEIWVSAWGSKDTPTFIVVYDALTLKEKARITGDWVRTPTGKFNVYNTAYDIY
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaacgttaggtttattaggatctctgctgctggccgctttggccttggcccag
gctcctgctcccttaagcccggcggagaaggaggaagcagccaaaatctactttgaccgc
tgcgctgggtgccatggggtgttgcggaagggagcgacgggtcccgcccttgaccctaag
aagatggcggaaaagggggtggagtacctgaaggcggtgatcttcggcggccttcctggg
ggcatgcccgattgggggcggcaggggattcttaaggaaaaggacatcgagctcgttgcc
cgcttccttttggagcagcccccagcgcctccagttcccacctttgaggagatcaaaaag
acctggaaggtgcacgtgcccccggagaagcggcccaccaaacctctccataaccgcaac
tggcagaacttcttcggccaggtgctccgggatacgggccaggtggccatcatcgacggg
gataagaaggagttggtgagcatcgtgcccacgggctttgccacccacatcttgcgctcc
tcagccacgggccggtacttcatggccatcggccgggacgggaaggcgagcctgatagac
ctctggatgaacccgccccaggtggtggcggagtccaagccctgcctggatgcccggtcc
attgagtccagcaagttcaagggctacgaggataagtatgcggtggtggggtgctactgg
ccgcctaccatggtggttctggatggcctcaccctcgagcccctcaagatggtctccacc
atctcctacgctaagggggccggggaactggtgatggaagcccgggtggccgccatcgtg
gcgagccactttaaccccgagtggatcgtaaacctcaaggagtcgggccagacctggctg
gtggactactccaatctgcacaagaaaggccggcccctgcccatcaccatgatcgacacc
aatctctttctgcacgatgggggctgggctctgaagcgctacttcatcgtggcggccaac
gcgttgaacaagctgatcgtaatagataccaagacccgggagttcgcagccgaggtggag
gcgggggtcaggccccacccgggccggggttccaactgggagcatcccacttacgggccg
gtttgggccaccgggaacatcggtagccccgaggtgaccgtggtgggtgtggatcccgaa
aagcatccccagtacgcctggaaggtggtcaagcggatcaccctgccctataccggcaac
ctcttcatcaagacccaccccaatagcccctgggtcatcgtggacttccccatgagcccg
agtccccaggcggctgccagcctctgcgccatagacaagcgcaagctggaggtggccaag
tgctgggaggtgccgggagcccaggagctgaaggcccgcatggtgcatcccgagttcaat
aagggtgggaccgagatctgggtttccgcctggggctctaaggacacccctaccttcatc
gtggtctacgatgcccttaccctcaaggaaaaggcccgcatcaccggggactgggtgcgc
acccctacggggaagttcaacgtgtacaacaccgcttacgacatctactag

DBGET integrated database retrieval system