KEGG   Thermus scotoductus: TSC_c17920Help
Entry
TSC_c17920        CDS       T01414                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tsc  Thermus scotoductus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TSC_c17920 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSC_c17920 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TSC_c17920 (trpA)
Enzymes [BR:tsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TSC_c17920 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1696674..1697453)
Genome map
AA seq 259 aa AA seqDB search
MTTREAFARAKAEGRAALIPYLTAGFPSREGFLQAVKEVLPYADLLEIGLPYSDPLGDGP
VIQRASEEALRKGMSVQGVLELFREVRALTEKPLFLMTYLNPVLAWGPERFFSLFKQAGA
TGLILPDLPPDEDPSLVRLAQEIGLETVFLLAPTSTDRRVETVVGYATGFIYAVSVTGVT
GERERLPDEVRDLVRRIKAKTSLPVAVGFGVSGRETAAQAAVADGVVVGSALVRALEGGR
PLAPLLEEIRQGLLQKEPA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccactagggaagccttcgctcgggccaaggccgagggccgggccgccttgatccct
tacctcaccgcgggcttccccagccgggaagggttcttgcaggcggtgaaggaggtactg
ccctacgccgatcttttggagattggcctcccctactccgatcccctgggagacggcccg
gtgatccagcgggccagcgaggaggccttgaggaaggggatgagcgtccagggcgttttg
gagctcttccgggaggtgcgggccctcaccgaaaagccccttttcctcatgacctacctg
aaccccgtgctggcctgggggccggagcggttcttcagccttttcaagcaggcgggggcc
acgggcctcatcctgcccgaccttcctcccgatgaggacccttccctggtgcgcctggcg
caggagatcggcctggaaacggtatttctcctggcccccacctccacggatcggcgggtg
gaaaccgtggtgggctacgccaccgggttcatctatgcggtttccgtcaccggggtcacc
ggggagcgggagcgcctgcccgacgaggtgcgggacctggtgcggcggatcaaggccaaa
acctccttgcccgtggccgtgggctttggggtttcggggcgggaaaccgcggcccaggcg
gcggtggccgacggggtggtggtgggaagcgccttggtgcgggccctcgaggggggtcgg
cccctggcccctctcctcgaggagatccgccaagggcttttgcagaaggaacccgcttag

DBGET integrated database retrieval system