KEGG   Thermus scotoductus: TSC_c18700Help
Entry
TSC_c18700        CDS       T01414                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tsc  Thermus scotoductus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TSC_c18700
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TSC_c18700
Enzymes [BR:tsc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TSC_c18700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1773459..1774919
Genome map
AA seq 486 aa AA seqDB search
MTLEELFAPFGLKAPPLRVLGLTLDSRRVEPGYVFVAVLGVPLPHRKPLDGHDFIPEALA
KGAIAVVGERELSLPVPYLRVGDAREALAHLARHFFGEPDRKLALLGITGSKGKSTTASL
LHHLLQAGEKPAALLSTVGLRLGEEARPNIGHFTTPEAPQVYGFLREAVERGLEAAVLEV
SSHALALKRVEGLSYRIGVFVSFYPDDHLDLHGTAEAYFAAKALLVERSHLAVLNTRLPH
LKRLLPRPHLLFGPGGEVWGEGLREGEEGLRFTLHTPWGSGEAFLPMLGRYNLDNALAAS
AAALAYGLSLERVLQGLATFRGVPGRMEVVQRKPFRVVIDFAHTGKSLEEALKTLRATTR
GRLLLVVGAAGERDPRRREDIGRVAARLADKTFFTEEDHRTEDLQAILEALAKAAREEGG
LYELIPDRKEAIFCALSEAREGDTVLLAGKGHEHTLERGTLALPWDEKAVALEGLKALGL
GGSEHP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgaggaactcttcgccccctttggcctcaaggccccgccccttagggtctta
ggcctcaccctggactcgaggcgggtggaacccggttatgtcttcgtggccgtgctcggg
gtgccccttccccaccgcaagcccttggacgggcacgactttatccccgaagccctggcc
aagggggccatcgccgtggtgggggaaagggagttaagccttcccgtgccctacttgcgg
gtgggggacgcccgggaggccttggcccacctggcccgccacttcttcggcgaacccgac
cggaaactggccctcttgggcatcaccggttccaaggggaagagcaccacggcaagcctc
cttcaccacctcctgcaagccggcgaaaaacctgccgccctcctctccaccgtgggcctc
cgcctgggagaggaggcccgccctaacatcggccatttcaccacccccgaggccccccag
gtgtacgggtttttgcgggaagccgtggagagggggctggaagctgcggtgctggaggtt
tccagccacgccctggccctgaagcgggtggaggggctttcctaccgcatcggggtcttc
gtgagcttctaccccgacgaccacctggacctgcacggcaccgccgaggcctactttgcc
gccaaggcccttttggtagagcgctcccacctggccgttttaaacacccgcctgccccat
ctgaagcgccttcttcccaggccccatcttctcttcggaccgggtggggaggtgtggggg
gagggcttgcgggaaggggaggaaggcctccgctttaccctgcataccccctggggctcg
ggggaagcctttttgcccatgctggggaggtacaacctggataacgccctggccgccagc
gccgccgccttggcctatgggctttccctggaaagggtgcttcagggcctcgccaccttt
aggggggtgccggggcggatggaggtggtgcagagaaagcccttccgggtggtcatcgac
ttcgcccacacgggaaaaagcctggaggaggccctaaagaccctgcgggccaccacccgg
ggaaggcttcttctggtggtgggggctgccggggaacgggatccgaggaggcgggaggat
atcgggcgggtggcggcgaggcttgccgacaagacctttttcaccgaggaggaccaccgc
acggaggacctccaggccatcctcgaggccctggccaaggccgccagggaggaggggggc
ctttacgagctcatccccgaccgcaaggaagccatcttctgcgccctttccgaggcccgg
gaaggggacaccgtcctccttgccggcaaggggcacgagcacaccctggaaaggggcact
ttggccctgccctgggacgagaaggcggtggccctggaggggcttaaggccctgggccta
ggtggaagcgagcatccctag

DBGET integrated database retrieval system