KEGG   Thermus scotoductus: TSC_c18980Help
Entry
TSC_c18980        CDS       T01414                                 

Definition
(GenBank) succinate dehydrogenase, membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tsc  Thermus scotoductus
Pathway
tsc00020  Citrate cycle (TCA cycle)
tsc00190  Oxidative phosphorylation
tsc00650  Butanoate metabolism
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01130  Biosynthesis of antibiotics
tsc01200  Carbon metabolism
Module
tsc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tsc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tsc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TSC_c18980
   00650 Butanoate metabolism
    TSC_c18980
  Energy metabolism
   00190 Oxidative phosphorylation
    TSC_c18980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt BCD
Motif
Other DBs
NCBI-ProteinID: ADW22511
UniProt: E8PMH0
Position
complement(1801949..1802344)
Genome map
AA seq 131 aa AA seqDB search
MAIKSKRYEEARLEASTNLELYWWVFMRISGVVLVFLLIGHMWMNAVITDLNSIDYEYVA
KRLSQTTWKIYDLLILALGLLHGANGLRYVLDDWIRNPSRRFWTKVVLYSLIAFLFFLGS
LSLLNHDFGVN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaagtccaagcgttatgaggaagcccgcctcgaggccagcaccaacctggag
ctttactggtgggtcttcatgcgcatctccggggtggtgttggtcttcctgctcatcggc
cacatgtggatgaacgccgtcatcaccgacctcaacagcattgactacgagtacgtggcc
aagagactttcccagaccacctggaagatctacgaccttttgatcctggccttgggcctc
ttgcacggggccaacgggcttaggtatgtgctggacgactggattcggaacccgtccagg
cgcttctggaccaaggtggtgctctacagcctcatcgcctttcttttcttcctggggagc
ctttcccttctcaatcacgatttcggggtgaactag

DBGET integrated database retrieval system