KEGG   Thermus scotoductus: TSC_c19570Help
Entry
TSC_c19570        CDS       T01414                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tsc  Thermus scotoductus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TSC_c19570 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSC_c19570 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TSC_c19570 (thrC)
Enzymes [BR:tsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TSC_c19570 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856879..1857934
Genome map
AA seq 351 aa AA seqDB search
MRLPLIERYRAHLPVSLNTPVISLLEGSTPLMPLKGPEEAQRRGIRLYAKFEGLNPTGSF
KDRGMTLAVSKAVEEGAKAVAAASTGNTAASAAAYAARAGIRAIVILPAGYVALGKVAQS
LVHGARIIQIEGNFDQALALTKALTEAYPVALVNSLNPYRLEGQKTLAFEVVDELRDAPQ
YHALPVGNAGNITAHWMGYKEYHALGKASRLPRMLGFQAAGAAPLVLGRPVEKPETLATA
IRIGNPASWQGAMRAKEESGGTIEAVTDEEILLAYRYLAQEEGIFCEPASAAAMAGVWKL
LREDRLDPGSTVVLTLTGHGLKDPATAEKVAELLPPVPANLEAVAEAAGLL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttcccctcatcgagcggtaccgggcccaccttcccgtgtctctcaacacgccc
gtgatctcccttttggagggctccacccccttgatgcccttaaaaggccctgaggaagcc
caaagacggggcatacgcctctatgccaagttcgaggggctgaaccccacggggagcttc
aaggaccggggcatgaccctggcggtttccaaggcggtggaggaaggagcgaaggcggtg
gcggctgccagcacgggaaacaccgccgccagcgccgccgcctacgccgcccgtgcgggg
ataagggccatcgtcatcctgcccgcgggctacgtggccctgggcaaggtggcccagagc
ctggtccatggggcgcggattatccaaatcgaaggcaacttcgaccaggccttggccctt
accaaggccctcaccgaggcctatcccgtggccctggtgaactccttgaacccctaccgc
ctggaaggccagaagaccctggccttcgaggtggtggacgagctgcgggatgccccccag
taccacgccctgcccgtgggcaacgccggtaacatcaccgcccactggatgggctacaag
gaataccacgccttgggcaaggcgagccgcctcccccggatgctgggcttccaggcggcg
ggcgccgctcccttggtcctggggcggcccgtggagaagccggaaaccctggccaccgcc
atccgcatcggcaacccggccagctggcaaggagccatgcgggccaaggaggaatccggc
gggacgatagaggcagtgacagacgaggaaatcctcctcgcctaccgctacctggcccag
gaggaaggaatcttctgcgagcccgcctccgccgccgccatggccggggtgtggaagctc
ctcagggaggatcggttggatccgggaagcaccgtggtcctcaccctcacgggccacggc
ctcaaggacccggccaccgcggaaaaggtggccgagcttctacccccggtgccagcgaac
ctcgaggcggtagccgaggccgcggggctattgtga

DBGET integrated database retrieval system