KEGG   Thermus scotoductus: TSC_c19570Help
Entry
TSC_c19570        CDS       T01414                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tsc  Thermus scotoductus
Pathway
tsc00260  Glycine, serine and threonine metabolism
tsc00750  Vitamin B6 metabolism
tsc01100  Metabolic pathways
tsc01110  Biosynthesis of secondary metabolites
tsc01120  Microbial metabolism in diverse environments
tsc01230  Biosynthesis of amino acids
Module
tsc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSC_c19570 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TSC_c19570 (thrC)
Enzymes [BR:tsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TSC_c19570 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADW22568
UniProt: E8PMV5
Position
1856879..1857934
Genome map
AA seq 351 aa AA seqDB search
MRLPLIERYRAHLPVSLNTPVISLLEGSTPLMPLKGPEEAQRRGIRLYAKFEGLNPTGSF
KDRGMTLAVSKAVEEGAKAVAAASTGNTAASAAAYAARAGIRAIVILPAGYVALGKVAQS
LVHGARIIQIEGNFDQALALTKALTEAYPVALVNSLNPYRLEGQKTLAFEVVDELRDAPQ
YHALPVGNAGNITAHWMGYKEYHALGKASRLPRMLGFQAAGAAPLVLGRPVEKPETLATA
IRIGNPASWQGAMRAKEESGGTIEAVTDEEILLAYRYLAQEEGIFCEPASAAAMAGVWKL
LREDRLDPGSTVVLTLTGHGLKDPATAEKVAELLPPVPANLEAVAEAAGLL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttcccctcatcgagcggtaccgggcccaccttcccgtgtctctcaacacgccc
gtgatctcccttttggagggctccacccccttgatgcccttaaaaggccctgaggaagcc
caaagacggggcatacgcctctatgccaagttcgaggggctgaaccccacggggagcttc
aaggaccggggcatgaccctggcggtttccaaggcggtggaggaaggagcgaaggcggtg
gcggctgccagcacgggaaacaccgccgccagcgccgccgcctacgccgcccgtgcgggg
ataagggccatcgtcatcctgcccgcgggctacgtggccctgggcaaggtggcccagagc
ctggtccatggggcgcggattatccaaatcgaaggcaacttcgaccaggccttggccctt
accaaggccctcaccgaggcctatcccgtggccctggtgaactccttgaacccctaccgc
ctggaaggccagaagaccctggccttcgaggtggtggacgagctgcgggatgccccccag
taccacgccctgcccgtgggcaacgccggtaacatcaccgcccactggatgggctacaag
gaataccacgccttgggcaaggcgagccgcctcccccggatgctgggcttccaggcggcg
ggcgccgctcccttggtcctggggcggcccgtggagaagccggaaaccctggccaccgcc
atccgcatcggcaacccggccagctggcaaggagccatgcgggccaaggaggaatccggc
gggacgatagaggcagtgacagacgaggaaatcctcctcgcctaccgctacctggcccag
gaggaaggaatcttctgcgagcccgcctccgccgccgccatggccggggtgtggaagctc
ctcagggaggatcggttggatccgggaagcaccgtggtcctcaccctcacgggccacggc
ctcaaggacccggccaccgcggaaaaggtggccgagcttctacccccggtgccagcgaac
ctcgaggcggtagccgaggccgcggggctattgtga

DBGET integrated database retrieval system