KEGG   Thermus scotoductus: TSC_c21330Help
Entry
TSC_c21330        CDS       T01414                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tsc  Thermus scotoductus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tsc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017960..2018544
Genome map
AA seq 194 aa AA seqDB search
MRYPESLLKLARALSRLPGIGPKTAQKLSLHLAFHREEAEELERALAGLEALGVCRVCGN
LAEGELCPICQDETRDRSVIAVVETVSDLYALERSGEFHGLYHVLGGALNPLEGVGPREL
NLESLWARLSGVEEVVLATSMTVEGEATALFLAEELKRRGIRASRLAYGLPVGGSLEYVD
EVTLGRALEGRKPL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacccggaaagcctcctcaagctggcccgcgccctctcccgcctgcctgggatc
ggccccaagaccgcccagaagctttcccttcacctggccttccaccgggaggaggccgag
gagctggaaagggccctggcgggcctcgaggccctgggcgtctgccgggtctgcggcaac
ctggcggagggggagctttgccccatctgccaggacgaaacccgggaccggtcggtgatc
gccgtggtggaaacggtctccgacctgtacgccctggaacggagcggggagttccacggg
ctttaccacgtgctgggtggagccttgaaccctctggaaggagtgggtccaagggagctc
aacctggaaagcctctgggccaggctttccggggtggaggaggtggtcctggccacctcc
atgaccgtggagggggaggccaccgccctcttcctggcggaggagctcaagcgccggggg
atcagggccagccgcctggcctacggcctccctgtggggggaagcctggagtacgtggac
gaggtaaccttaggccgggccctggaggggaggaaacccctttag

DBGET integrated database retrieval system