KEGG   Thermus scotoductus: TSC_c22360Help
Entry
TSC_c22360        CDS       T01414                                 

Gene name
rpmC
Definition
50S ribosomal protein L29
Orthology
K02904  
large subunit ribosomal protein L29
Organism
tsc  Thermus scotoductus
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    TSC_c22360 (rpmC)
Ribosome [BR:tsc03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    TSC_c22360 (rpmC)
  Archaea
    TSC_c22360 (rpmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2101459..2101656)
Genome map
AA seq 65 aa AA seqDB search
MKPSEIRKLSPSEIEKLVREKKRELMELRFQASIGQLSQNHRIRETRRLIARLLTILNER
RRANA
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagtgagatccgcaagctctctcccagtgagatcgagaagctggttcgggag
aagaagcgggagctgatggagcttcgcttccaggcctccatcggccagctctcccagaac
cacaggatccgggagacccggcgcctcatcgcccggctcctcacgatcctgaacgagagg
aggagggccaatgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system