KEGG   Thermus scotoductus: TSC_c22360Help
Entry
TSC_c22360        CDS       T01414                                 

Gene name
rpmC
Definition
50S ribosomal protein L29
Orthology
K02904  
large subunit ribosomal protein L29
Organism
tsc  Thermus scotoductus
Pathway
Ribosome
Class
Genetic Information Processing; Translation; Ribosome [PATH:tsc03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2101459..2101656)
Genome map
AA seq 65 aa AA seqDB search
MKPSEIRKLSPSEIEKLVREKKRELMELRFQASIGQLSQNHRIRETRRLIARLLTILNER
RRANA
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagtgagatccgcaagctctctcccagtgagatcgagaagctggttcgggag
aagaagcgggagctgatggagcttcgcttccaggcctccatcggccagctctcccagaac
cacaggatccgggagacccggcgcctcatcgcccggctcctcacgatcctgaacgagagg
aggagggccaatgcctaa

DBGET integrated database retrieval system