KEGG   Thermus scotoductus: TSC_c22360Help
Entry
TSC_c22360        CDS       T01414                                 

Gene name
rpmC
Definition
50S ribosomal protein L29
Orthology
K02904  
large subunit ribosomal protein L29
Organism
tsc  Thermus scotoductus
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    TSC_c22360 (rpmC)
Ribosome [BR:tsc03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    TSC_c22360 (rpmC)
  Archaea
    TSC_c22360 (rpmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2101459..2101656)
Genome map
AA seq 65 aa AA seqDB search
MKPSEIRKLSPSEIEKLVREKKRELMELRFQASIGQLSQNHRIRETRRLIARLLTILNER
RRANA
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagtgagatccgcaagctctctcccagtgagatcgagaagctggttcgggag
aagaagcgggagctgatggagcttcgcttccaggcctccatcggccagctctcccagaac
cacaggatccgggagacccggcgcctcatcgcccggctcctcacgatcctgaacgagagg
aggagggccaatgcctaa

DBGET integrated database retrieval system