KEGG   Thermus scotoductus: TSC_c22580Help
Entry
TSC_c22580        CDS       T01414                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tsc  Thermus scotoductus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TSC_c22580
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TSC_c22580
   00650 Butanoate metabolism
    TSC_c22580
  Lipid metabolism
   00071 Fatty acid degradation
    TSC_c22580
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TSC_c22580
   00310 Lysine degradation
    TSC_c22580
   00360 Phenylalanine metabolism
    TSC_c22580
   00380 Tryptophan metabolism
    TSC_c22580
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TSC_c22580
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TSC_c22580
   00281 Geraniol degradation
    TSC_c22580
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TSC_c22580
   00627 Aminobenzoate degradation
    TSC_c22580
   00930 Caprolactam degradation
    TSC_c22580
Enzymes [BR:tsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TSC_c22580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2116636..2117421
Genome map
AA seq 261 aa AA seqDB search
MDLEGRYPSLSFTWPRPGVLEITLRGGKLNALGPEAHRDLARIWRDLGELEEVKAVLLRG
EGGVFSAGGSFALIEEMRSSHQALMRVFWEARELVLGPMDFPRPVVAAVEGVAVGAGLAL
ALASDVVVVGKKARLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAER
LGLVALAVEDEKVYEKALEVATRLAEGPKEALSLTKHALNNWFRTFVPHFEVSLALEFLG
FQGEALEEGLRALKEKRKPQF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggacctagaaggccgttaccccagcctttccttcacctggccccggcccggggtgctg
gagatcaccctgcgggggggaaaactcaacgccttgggccccgaagcccaccgggacctg
gcccgcatctggcgggacttaggggagctcgaggaagttaaggccgttcttttgaggggc
gagggtggggtcttctccgccgggggttccttcgccctcatcgaggaaatgcgctcctcc
caccaagccttgatgcgggtcttttgggaggcgagggagctggtgctcgggcccatggac
ttccccaggccggtggtggccgcggtggagggggtggcggtgggagcggggctggccttg
gccctggccagcgacgtggtggtggtgggcaagaaggccaggcttctggacggtcacctt
aggcttggggtggcagccggggaccatgcggtcctcctgtggcccctcctggtgggcatg
gccaaggccaagtaccacctcctcctcaatgaacccctcaccggggaagaagcggagcgg
ctgggcctggtggccctggccgtggaggatgagaaggtgtacgaaaaggccctcgaggtg
gccacgcgcctggccgaaggccctaaggaggccctaagcctcaccaagcacgccctgaac
aactggttccgcaccttcgtgccccactttgaggtgtccttggccctggagtttttgggg
ttccaaggagaagcattggaagaagggctacgggcgcttaaggaaaagcgcaaaccccag
ttctag

DBGET integrated database retrieval system