KEGG   Thermus scotoductus: TSC_c22840Help
Entry
TSC_c22840        CDS       T01414                                 

Gene name
mce
Definition
methylmalonyl-CoA epimerase (EC:5.1.99.1)
Orthology
K05606  
methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
tsc  Thermus scotoductus
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c22840 (mce)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TSC_c22840 (mce)
   00640 Propanoate metabolism
    TSC_c22840 (mce)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TSC_c22840 (mce)
Enzymes [BR:tsc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     TSC_c22840 (mce)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2145147..2145548)
Genome map
AA seq 133 aa AA seqDB search
MCLHHVGIAVEDLEEAKARYGLLGFGVVAEGEVAAQGVRVALLEGEGETLLELLAPLGPD
TPVGRFLAKRGPGLHHLAFATSRIEEELARLKGVGARLIDEVPRPGFGGHRVAFLHPGFG
LGVLWELVETEGA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttacaccacgtgggcattgcggtggaggacctagaggaggccaaggcccgttac
gggcttttgggttttggcgtggtggcggaaggggaggtggccgcccagggggtgcgggtg
gccctcctcgagggggaaggggagacccttctggagctcctcgcccccttggggccggat
accccggtggggcgctttctggccaagcggggccctgggcttcatcacctggcctttgcc
acctcccggattgaggaggagcttgcccggctgaagggggtgggagccaggctcatcgac
gaggtcccccggccgggttttggcgggcaccgggtggccttcctccaccccggctttggc
ctcggggtgctttgggaactggtggagacggagggtgcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system