KEGG   Thermus scotoductus: TSC_c22840Help
Entry
TSC_c22840        CDS       T01414                                 

Gene name
mce
Definition
methylmalonyl-CoA epimerase (EC:5.1.99.1)
Orthology
K05606  
methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
tsc  Thermus scotoductus
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tsc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tsc00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tsc00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tsc00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2145147..2145548)
Genome map
AA seq 133 aa AA seqDB search
MCLHHVGIAVEDLEEAKARYGLLGFGVVAEGEVAAQGVRVALLEGEGETLLELLAPLGPD
TPVGRFLAKRGPGLHHLAFATSRIEEELARLKGVGARLIDEVPRPGFGGHRVAFLHPGFG
LGVLWELVETEGA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttacaccacgtgggcattgcggtggaggacctagaggaggccaaggcccgttac
gggcttttgggttttggcgtggtggcggaaggggaggtggccgcccagggggtgcgggtg
gccctcctcgagggggaaggggagacccttctggagctcctcgcccccttggggccggat
accccggtggggcgctttctggccaagcggggccctgggcttcatcacctggcctttgcc
acctcccggattgaggaggagcttgcccggctgaagggggtgggagccaggctcatcgac
gaggtcccccggccgggttttggcgggcaccgggtggccttcctccaccccggctttggc
ctcggggtgctttgggaactggtggagacggagggtgcgtag

DBGET integrated database retrieval system