KEGG   Thermus scotoductus: TSC_c23750Help
Entry
TSC_c23750        CDS       T01414                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tsc  Thermus scotoductus
Brite
Enzymes [BR:tsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TSC_c23750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2232596..2233294
Genome map
AA seq 232 aa AA seqDB search
MNLLLLHGFTSHPVLTLGPLPQVLREAGFQVSQPALPGHGTRPEDLLKVRWQDWLETARA
FYRELPEPRGVVGLSMGALLSAHLAAETPTQALVALAPAMALKHPLAPLAPLLAWLIPRF
PGPDSIQDPELKKQNPNYPYFPTRALLQLLALMRRTPEVLPKVKANALVIEAGQDKVVDP
AGVRGYHALLGSSRKEYLVFPESGHDLLLDQDREAVALAVRDWLIANSTHLH
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcctcttgcttcacgggtttacctcgcatcccgtcctcaccctgggtcccttg
ccccaggtgttgcgggaggctgggtttcaggtgagccagccagcccttcccggccacggc
acccggccggaggacctcctcaaggtgcggtggcaggactggctggaaacagcccgggct
ttttaccgggaactgcccgagcctcgaggggtggtggggctttccatgggggccctgctt
tccgcccacctggcggcggaaacccccacccaggccctggtagccctggccccggccatg
gccctcaagcatccccttgcccccctggcgcccctcctggcctggctgatcccccgcttt
cccggccccgattccatccaggatcccgagctcaagaagcaaaatcccaactacccctac
ttccccacccgggccctgcttcagcttctggccttaatgcgccgcaccccggaggtcctg
cccaaggtgaaggccaacgccctggtgatcgaggcgggccaggacaaggtggtggacccc
gcaggggtgcggggctaccatgcccttttgggaagctcgaggaaggagtacctggtcttt
cccgaaagcggacacgaccttcttctggaccaggaccgggaggcggtggccctggcggtc
cgggattggcttattgctaatagtactcacttgcattaa

DBGET integrated database retrieval system