KEGG   Thermus scotoductus: TSC_c24010Help
Entry
TSC_c24010        CDS       T01414                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tsc  Thermus scotoductus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tsc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2254323..2254931)
Genome map
AA seq 202 aa AA seqDB search
MERKMVELEDTGLTFETHVDLGRLKRLAAEWLEVIGEDPSREGLLKTPERVAKAWAFLTR
GYRQDLKAIVNGALFPAEGSEMVVVKGIEFYSMCEHHLLPFFGQVHIGYIPGEKILGLSK
FARIVDMFARRLQVQERLAVQIAEAIQEILEPQGVGVVVEGVHLCMMMRGVEKQHSRTTT
SAMLGVFRESQKTREEFLSHLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaagatggtggagctcgaggatacgggtcttacctttgaaacccacgtggac
ctggggcgcctgaagcgcctggcagcggaatggctggaggtcatcggggaggatcccagc
cgggaaggcctcctgaaaacccccgagcgggtggccaaggcctgggccttcctcacccgg
ggctaccgccaggacctgaaggccatcgtcaacggggccctcttccccgccgaggggagc
gagatggtggtggtgaagggcatagagttctactccatgtgcgagcaccatctcctgccc
ttcttcggccaggtgcacatcggctatatcccgggcgagaagatcctgggcctttccaag
ttcgcccgcatcgtggacatgtttgcgagaaggctgcaggtgcaggaacgcctggcggtg
cagatcgccgaggccatccaggagatcctcgagccccagggggtgggggtggtggtggaa
ggggtccacctctgcatgatgatgcggggggtggagaagcagcactcccgcaccaccacc
agcgccatgctgggagtcttccgggaaagccagaagacccgggaggagttcctgagccac
ctaaagtga

DBGET integrated database retrieval system