KEGG   Thermus scotoductus: TSC_c24940Help
Entry
TSC_c24940        CDS       T01414                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tsc  Thermus scotoductus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tsc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TSC_c24940 (pfkA)
   01230 Biosynthesis of amino acids
    TSC_c24940 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSC_c24940 (pfkA)
   00030 Pentose phosphate pathway
    TSC_c24940 (pfkA)
   00051 Fructose and mannose metabolism
    TSC_c24940 (pfkA)
   00052 Galactose metabolism
    TSC_c24940 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    TSC_c24940 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TSC_c24940 (pfkA)
Enzymes [BR:tsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TSC_c24940 (pfkA)
Protein phosphatases and associated proteins [BR:tsc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TSC_c24940 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2336148..2337116)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAYALGLEVIGIRRGYAGMILGEMVPLGVRDVANI
LQRGGTVLLTARSQEFLTEEGRAKAAEKLKAAGIEGLVAIGGDGTFRGAMRLLEEHKVPV
VGVPGTIDNDLYGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRDSGFIALD
VGLAGGAEVIAVPEEPVDPRAIAEGLLESQRRGKTSSIVVVAEGAYPGGAAGLLAAIQEH
VRVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALAGGTSGVMVGEVEGEVELTPLK
EAVERKKDINRSLLALSRVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcataggggtgtttacttccggcggcgatgccccggggatgaatgcggccatc
agggcggtggtgcgccaggcctatgccttgggcctcgaggtgatcggcatccgccgcggc
tatgcgggcatgatcctgggggagatggtgcccttgggggtgcgggatgtggccaacatc
cttcagcgggggggaaccgtcctcctcaccgcaagaagccaggagttcctcacggaggag
ggccgggccaaggcggcggagaagctcaaagcggcgggcatcgagggcctggtggccatc
ggaggggacggtacctttcgcggggccatgcgccttttggaggagcataaggtccccgtg
gtaggggtgcccggcaccatcgacaacgacctttacggcaccgattacaccattggcttt
gacaccgcggtgaacacggccctcgaggccatagaccgcatccgggataccgcagccagc
cacgagcgggtcttcttcatcgaggtcatggggcgggactccgggttcatcgccctggat
gtggggctggctgggggggccgaggtgatcgccgtgcccgaggaacccgtggaccccagg
gccatcgccgagggcctcctggagtcccaaaggcggggaaaaaccagctccattgtggtg
gtggccgagggcgcctaccccgggggggcggcggggctccttgccgccatccaggagcac
gtgcgggtggaggcccgggtcacggtcctgggccatatccagcgggggggaagccccacc
gccaaggaccgcatcctggcaagccgcctaggggcggcggcggtggaggccctggccggg
gggaccagcggggtcatggtgggggaggtggagggggaggtggagctcacccccctcaag
gaggcggtggagcgtaagaaggacatcaaccgctcccttctggccctgtcgcgggttctg
gccctctag

DBGET integrated database retrieval system