KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0127Help
Entry
Tsac_0127         CDS       T02137                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tsac_0127
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Tsac_0127
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Tsac_0127
Two-component system [BR:tsh02022]
 CheA family
  CheA-CheYBV
   Tsac_0127
Bacterial motility proteins [BR:tsh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Tsac_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(128010..129065)
Genome map
AA seq 351 aa AA seqDB search
MEKFGVLVVDDSSFMRKCITKIIEKNPKLYVVGIARDGYEAIEKVQNLNPDVVTMDIEMP
NMNGIMALKKIKELHDIPIVMLSNYTEEGAKPTIEALEAGAEDFFLKSELIKQDVDDKVI
DYFINKLINIVESKKVQKQCLKINMDEMVNKRVLNNDKPNAKTNIIIIGTSTGGPAALQS
ILPNFPADLSVPVLVLQHMPPGFTKSLAERFDTFCQLHVKEAEDDEVLQSGNIYIAPSGF
QTTLHLRSDNRVSFKITDSSNDNNLYKPSIDVTLNSAAPIYKDHLLVAILTGMGNDGVVG
CKSVKENGGHVIIESENTCVVYGMPKAVFEAKLYDVQVPLQDVLKEILTYV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttggtgttttagttgtggatgattcgtcttttatgagaaagtgtattact
aaaatcatagaaaagaatcctaaactttatgttgtaggaatcgccagagatggatatgaa
gcgatagaaaaagttcaaaatcttaatcctgatgtagtaactatggatattgaaatgcct
aatatgaacggcattatggctcttaaaaagattaaagaattgcatgatatacctattgtg
atgctgagcaattatacggaggaaggtgctaaacccactatagaagcgttggaggcaggc
gcagaagatttttttctaaaaagcgagttaatcaagcaagatgttgatgataaggttatc
gattattttataaataaattgataaatattgtagaaagcaagaaagtgcaaaagcaatgt
ttaaaaatcaacatggatgaaatggttaataagagagttcttaacaatgataaaccaaat
gcaaagacaaatataattattataggcacatctacaggaggaccagccgctttacaatct
atactgcccaatttcccagcagatttatccgttcccgtacttgtcctccaacatatgccg
ccaggttttactaagtctttagctgaaagatttgatacattctgccaacttcatgtaaaa
gaagcagaggatgatgaagttttgcaaagtggcaacatttatatagctccatcgggattt
caaactactttgcatttaagaagtgataatagagtttctttcaaaatcacagacagttca
aatgataacaatttatataaaccatcaattgatgttacgttaaattctgcagcaccgata
tataaagaccatttattagttgccatacttactggtatgggcaatgatggagttgtcgga
tgcaaatcagtaaaagagaatgggggccatgttattattgaatctgaaaatacatgtgtt
gtttatggaatgccaaaggctgtttttgaagctaaactatacgatgttcaagtgccgttg
caggatgttttaaaggaaatattgacgtatgtgtga

DBGET integrated database retrieval system