KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0200Help
Entry
Tsac_0200         CDS       T02137                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tsac_0200
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tsac_0200
   00600 Sphingolipid metabolism
    Tsac_0200
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tsac_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(208843..210240)
Genome map
AA seq 465 aa AA seqDB search
MRYTDGKVHDITIAYIGGGSRGWAWNLMTDLAKEESISGTVKLYDIDYDAAHDNEIIGNA
LSMRQDVKGKWLYKACETLEESLKGADFVIISILPGTFDEMESDVHAPEKYGIYQSVGDT
VGPGGIVRALRTIPMFVDIANAIKEHCPDAWVINYTNPMTLCVRTLYEIFPQIKAFGCCH
EVFGTQKLLSRALQDIEGIENVPREEIKINVLGINHFTWIDNARYKDIDLMYVYKQFVNK
YYESGFVSDANNNWMNNSFVSAERVKFDLFLRYGVIAAAGDRHLAEFVPGYWYLKDPETV
REWMFGLTTVSWRKEDLKRRLERSKRLKTGEEKFELKETGEEGVRQIKALLGLGDLVTNV
NMPNHGQIEGIPYGAVVETNALFSGNKLKPVLSGKLPDNVNSLVLRQVYNQETTLKAALK
RDFDLAFSAFVNDPLVTISLKDAKKLFKEMLENTKKYLDGWKIKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagatatacagatggaaaggttcatgacattactattgcttatatcggtggtggttca
agaggatgggcgtggaatttaatgactgacttagcaaaagaggaaagtatttctggtaca
gtaaagttatacgacatagattacgatgcggcacatgacaatgagataataggcaatgct
ttatcaatgagacaggatgttaaaggcaaatggctttataaagcttgtgagacgttagaa
gagtcactaaaaggtgctgattttgtcataatatctattttgccaggtacgttcgacgag
atggaatctgatgttcatgcaccagaaaagtatggcatttatcagtcagtaggtgataca
gtaggacctggtggaatagtcagagctttaaggacgattccgatgtttgtggacattgcc
aatgcgattaaagagcattgtccagatgcatgggtcataaattatacaaatcctatgaca
ctttgtgtaaggacattgtatgaaattttccctcaaattaaagcatttggatgctgccat
gaagtttttggcacacagaagctattatctcgtgctctgcaggatatagaaggcattgaa
aatgttccgagggaagagataaagataaatgttttaggtataaatcattttacgtggatc
gacaatgcaaggtacaaagacatagatttaatgtatgtttataaacaatttgtgaataag
tactatgaaagcggatttgtcagcgatgctaacaataattggatgaacaattcatttgta
tctgcagagagagtaaagtttgatctgtttttgaggtatggagtaatagctgcagcggga
gatagacatctggcggaatttgtgccgggatattggtatttaaaagatccagagacagtc
agagaatggatgtttggcttaacgactgtaagttggagaaaagaagacttaaaacgcagg
cttgaaagaagtaaaaggcttaagacaggtgaggaaaaatttgagttaaaggaaacaggc
gaagaaggtgttaggcaaattaaagcactattaggcttaggcgatttagtgactaatgtc
aacatgccgaaccatggacagattgaaggaataccatacggtgcggtagttgaaacaaac
gctttattttcaggtaataaactaaagcctgtattatcaggaaaattgcctgacaatgta
aacagcctcgtgttaaggcaagtatacaaccaagaaacgacgttgaaagctgctttaaag
agagattttgatttggcttttagtgcttttgtaaatgatccacttgttacaatatcttta
aaagatgcaaaaaaattatttaaggaaatgcttgaaaatacgaagaaatatctagatgga
tggaaaataaaagcttga

DBGET integrated database retrieval system