KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0277Help
Entry
Tsac_0277         CDS       T02137                                 

Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tsac_0277
   00051 Fructose and mannose metabolism
    Tsac_0277
Enzymes [BR:tsh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Tsac_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(290152..291471)
Genome map
AA seq 439 aa AA seqDB search
MNKYFENVSKIKYEGPKSNNPYSFKFYNPEEVIDGKTMEEHLRFSIAYWHTFTADGTDQF
GKATMQRPWNHYTDPMDIAKARVEAAFEFFDKINAPFFCFHDRDIAPEGDTLRETNKNLD
TIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGASTSCNADVFAYSAAQVKKALEITKEL
GGENYVFWGGREGYETLLNTDMEFELDNFARFLHMAVDYAKEIGFEGQFLIEPKPKEPTK
HQYDFDVANVLAFLRKYGLDKYFKVNIEANHATLAFHDFQHELRYARINGVLGSIDANTG
DMLLGWDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAKVRRASFEPEDLFLGHIAGM
DAFAKGFKVAYKLVKDGVFDKFIEERYASYKDGIGADIVSGKADFKSLEKYALEHSQIVN
KSGRQELLESILNQYLFAE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatattttgagaacgtatctaaaataaaatatgaaggaccaaaatcaaacaat
ccttattcttttaaattttacaatccagaagaagtaatcgatggcaagacgatggaggag
catctacgcttttctatagcttactggcacacttttactgctgatggaacagatcaattt
ggcaaagctaccatgcaaagaccatggaaccactacacagatcctatggacatagcaaag
gcaagggtagaagcagcatttgagttttttgataagataaatgcacctttcttctgcttc
catgacagggatattgcacctgaaggagacactcttagagagacaaacaaaaacttagat
acaatagttgccatgataaaggattacttgaagaccagcaagacgaaagttttgtggggc
accgcaaatcttttctccaatccgagatttgtacatggtgcatcaacatcctgcaatgct
gatgttttcgcatattctgcagctcaagttaaaaaagctcttgagattactaaggagctt
ggcggcgaaaactacgtattctggggtggcagagaaggatatgaaacacttctcaataca
gacatggagtttgagcttgacaactttgcaagatttttgcacatggctgttgactacgcg
aaggaaatcggctttgaaggccagttcttgattgagccgaagccaaaggagcctacgaaa
caccaatacgactttgacgtggcaaatgtattggcattcttgagaaaatacggccttgac
aaatatttcaaagtgaatatcgaggcaaaccatgcgacattggcattccacgacttccaa
catgagctaagatacgccagaataaacggtgtattaggatcaattgacgcaaatacaggc
gatatgcttttaggatgggatacagaccagttccctacagatatacgcatgacaacgctt
gctatgtatgaagtcataaagatgggtggatttgacaaaggcggccttaacttcgatgca
aaagtaagacgtgcttcatttgaaccagaagatcttttcttaggtcatatagccggaatg
gatgcctttgcaaaaggcttcaaagttgcttacaaacttgtgaaagatggcgtatttgac
aagttcatcgaggaaagatacgcaagctacaaagacggcattggcgctgacattgtaagc
gggaaagctgacttcaagagccttgaaaagtacgcattagagcacagccagattgtcaac
aaatcaggcaggcaagagctgttagaatcaatcctaaatcagtatttgtttgcagaataa

DBGET integrated database retrieval system