KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0308Help
Entry
Tsac_0308         CDS       T02137                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tsac_0308
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tsac_0308
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tsac_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(323976..325370)
Genome map
AA seq 464 aa AA seqDB search
MVLDQYVDALKDDLVKSTQEIIKIKSTEGDMKPGMPYGEGVAKALELALDIAKSLGFKTK
NVDGYVGYAEYGEGDEMVGVLGHLDVVPEGDGWEYPPYGGEIHDGKIYGRGATDDKGPIM
AALYALKAIKDSGLKLNKRVRILFGTNEETGSKEIEHYLKHDESPSIGFTPDANYPVIYA
EKGITMFEVVKDFEKKSQNIVIKYIKGGNRPNMVPDYCECGIYVKDEDKRKAFKDEVKRF
KDVSGFDLDSQVENDMLVVKSRGVSAHGSLPHLGKNAIMQLLMFLNVIYQDEDDVKEFID
FFAKNVGLETDGKTFGVYLKDDTGELSFNVGTINFDEEKGSIGLNIRYPVTYKYEDLMNP
FNAKISKHGMRVENMMHQPPLYFPKDHFLIKTLMKVYEDVTGRKDEPLSIGGGTYAKEMK
NMVAFGPIFPGKPDLDHQANEYIEIDDLVLNAKIYARAIYELAK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtattagatcagtatgtagatgctttaaaagacgacttagtcaagtcgacgcaagaa
atcatcaagataaaaagcactgagggggacatgaagccggggatgccttatggcgaagga
gtcgcaaaggcattggaattagctttagacatagctaaaagtttgggcttcaagacaaaa
aatgtagacggatatgtagggtatgcagaatacggggaaggcgatgagatggtaggcgtc
ttagggcatctggatgtagtgcctgaaggggacggctgggagtatccaccttatggcggc
gaaatccatgatggtaaaatatacggcaggggggcaacagacgataaaggacctataatg
gctgctctttacgcattaaaggccattaaagattctggacttaaattaaacaagagagta
aggatactttttggcacaaatgaggagacaggctctaaagagatagagcattaccttaaa
catgatgaatcaccatcaatcggctttacgccagatgccaattatccagtcatatacgca
gaaaaaggcatcaccatgtttgaagttgtaaaagattttgaaaaaaaatctcagaatatt
gtcataaagtatataaaaggcggcaataggcctaacatggttccagactactgtgaatgc
ggcatttatgtaaaagatgaagacaaaagaaaagcttttaaggatgaggttaagagattt
aaggatgtttcaggttttgatttagacagccaagtcgaaaacgacatgcttgtagtaaaa
tctcgtggcgtatcagcacatgggagccttccacaccttggaaagaatgcgataatgcag
cttttgatgtttttaaatgtcatctaccaagatgaagacgatgtaaaagaatttatagac
ttttttgctaaaaacgtcgggcttgagacagatggtaagacatttggagtttacttaaaa
gatgacacaggtgagctttcgtttaacgtaggcactataaattttgacgaggagaaaggt
tcaataggtttaaacatcaggtatcctgtgacttataagtacgaggatttgatgaatcca
tttaatgcgaaaataagtaaacacggaatgagagtagaaaacatgatgcatcagccgccg
ctttatttccctaaagatcatttcctaataaagacccttatgaaagtatatgaagatgtg
acgggaaggaaagatgaaccgttgtcgattggcggtggaacgtacgccaaagagatgaaa
aacatggtggcatttggaccgattttcccgggcaaaccagatcttgaccatcaggcaaat
gagtacattgagatagacgatctcgtcttaaacgccaagatatatgctcgtgccatatac
gagctggcaaaatag

DBGET integrated database retrieval system