KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0338Help
Entry
Tsac_0338         CDS       T02137                                 

Definition
(GenBank) glycoside hydrolase family 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00500  Starch and sucrose metabolism
tsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tsac_0338
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tsac_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_17_28 AAA_24
Motif
Other DBs
NCBI-ProteinID: AFK85368
UniProt: I3VS73
Position
complement(357448..358605)
Genome map
AA seq 385 aa AA seqDB search
MNKLHINKWYFFVGMLAMFAVIMSLILKDTSLTFGGYEQEKFPHLIGNSMVKKPSLAGRL
KIIEIDGRKTLGDQRGNPIQLRGMSTHGLQWFPQIINNNAFSALSKDWEANVIRLAMYVG
EGGYSTDPSVKEKVIEGINLAIKNDMYVIVDWHVLNPGDPNAKIYSGAKEFFKEIASKYP
NDLHIIYELTNEPNSTESDITNDIAGWEKVKKYAEPIIKMLRDMGNENIIIVGSPEWSTR
PDLAVNDPIDDKNVMYSAHFYTGSASVWENGNKGNIARNIEKALENGLAVFVTEWGTSEA
SGDGGPYLNEADEWLEFLNSNNISWVNWSLANKNEASAAFLPNISLDPGNGKVWTVNQLS
LSGEYVRARIKGIPYKPISRETMGK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaattgcatattaataaatggtacttttttgtaggtatgcttgctatgtttgct
gtaattatgagtctaatcttaaaagatacatctttaacctttggtggttatgaacaggaa
aaatttccacatttaataggaaattctatggtaaaaaaaccttcattagcgggtagactt
aaaattatagaaatagatggtagaaagacactgggggatcagcgcggtaatccaatacag
ttgagaggaatgagcacgcacggattacagtggttcccgcaaattattaataacaatgct
ttctctgctttatcgaaagattgggaagcaaatgtaatcagattggctatgtatgttggt
gaaggtggttattctacagatccaagtgttaaagaaaaagttatagaaggaataaattta
gcgattaagaatgatatgtatgtaatagttgactggcatgttttgaatcctggcgatcca
aacgcaaagatatatagtggtgcaaaagaattctttaaagaaatagctagtaaatatcca
aatgacttacatattatatatgagctcactaatgaaccaaattcaacagaatcagatata
acaaatgatattgcagggtgggaaaaagtaaaaaaatatgcagagccaattataaaaatg
ttaagagatatgggaaatgaaaatataataattgttggaagcccagaatggagtacaaga
cctgatttagcggtaaatgatcctatcgatgacaaaaatgttatgtatagtgctcatttt
tatactggaagtgctagtgtgtgggaaaatggcaataaaggaaatattgctagaaacatt
gaaaaagcacttgaaaatggcttagccgtatttgttacagaatggggaaccagtgaagca
agtggagatggaggcccgtatttaaatgaagcagatgaatggctggagtttttaaattct
aataatattagctgggttaattggtcattagctaataaaaatgaagcttcagccgcattt
ttaccaaatatttctttggatcctggtaatggtaaagtgtggacagtaaatcaattgagt
ctttcaggagaatatgtaagagctagaataaagggaattccttataaacctatttctcgc
gagacgatgggaaaataa

DBGET integrated database retrieval system