KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0338Help
Entry
Tsac_0338         CDS       T02137                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tsh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(357448..358605)
Genome map
AA seq 385 aa AA seqDB search
MNKLHINKWYFFVGMLAMFAVIMSLILKDTSLTFGGYEQEKFPHLIGNSMVKKPSLAGRL
KIIEIDGRKTLGDQRGNPIQLRGMSTHGLQWFPQIINNNAFSALSKDWEANVIRLAMYVG
EGGYSTDPSVKEKVIEGINLAIKNDMYVIVDWHVLNPGDPNAKIYSGAKEFFKEIASKYP
NDLHIIYELTNEPNSTESDITNDIAGWEKVKKYAEPIIKMLRDMGNENIIIVGSPEWSTR
PDLAVNDPIDDKNVMYSAHFYTGSASVWENGNKGNIARNIEKALENGLAVFVTEWGTSEA
SGDGGPYLNEADEWLEFLNSNNISWVNWSLANKNEASAAFLPNISLDPGNGKVWTVNQLS
LSGEYVRARIKGIPYKPISRETMGK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaattgcatattaataaatggtacttttttgtaggtatgcttgctatgtttgct
gtaattatgagtctaatcttaaaagatacatctttaacctttggtggttatgaacaggaa
aaatttccacatttaataggaaattctatggtaaaaaaaccttcattagcgggtagactt
aaaattatagaaatagatggtagaaagacactgggggatcagcgcggtaatccaatacag
ttgagaggaatgagcacgcacggattacagtggttcccgcaaattattaataacaatgct
ttctctgctttatcgaaagattgggaagcaaatgtaatcagattggctatgtatgttggt
gaaggtggttattctacagatccaagtgttaaagaaaaagttatagaaggaataaattta
gcgattaagaatgatatgtatgtaatagttgactggcatgttttgaatcctggcgatcca
aacgcaaagatatatagtggtgcaaaagaattctttaaagaaatagctagtaaatatcca
aatgacttacatattatatatgagctcactaatgaaccaaattcaacagaatcagatata
acaaatgatattgcagggtgggaaaaagtaaaaaaatatgcagagccaattataaaaatg
ttaagagatatgggaaatgaaaatataataattgttggaagcccagaatggagtacaaga
cctgatttagcggtaaatgatcctatcgatgacaaaaatgttatgtatagtgctcatttt
tatactggaagtgctagtgtgtgggaaaatggcaataaaggaaatattgctagaaacatt
gaaaaagcacttgaaaatggcttagccgtatttgttacagaatggggaaccagtgaagca
agtggagatggaggcccgtatttaaatgaagcagatgaatggctggagtttttaaattct
aataatattagctgggttaattggtcattagctaataaaaatgaagcttcagccgcattt
ttaccaaatatttctttggatcctggtaatggtaaagtgtggacagtaaatcaattgagt
ctttcaggagaatatgtaagagctagaataaagggaattccttataaacctatttctcgc
gagacgatgggaaaataa

DBGET integrated database retrieval system