KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0416Help
Entry
Tsac_0416         CDS       T02137                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tsac_0416
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tsac_0416
   00620 Pyruvate metabolism
    Tsac_0416
   00650 Butanoate metabolism
    Tsac_0416
  Lipid metabolism
   00071 Fatty acid degradation
    Tsac_0416
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tsac_0416
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tsac_0416
   00626 Naphthalene degradation
    Tsac_0416
Enzymes [BR:tsh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tsac_0416
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tsac_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447228..449807
Genome map
AA seq 859 aa AA seqDB search
MATTKTELDVQKQIDLLVSRAQEAQKKFMSYTQEQIDAIVKAMALAGVDKHVELAKMAYE
ETKMGVYEDKITKNLFATEYVYHDIKNEKTVGIINENIEENYMEVAEPIGVIAGVTPVTN
PTSTTMFKCLISIKTRNPIIFSFHPKAIKCSIAAAKVMYEAALKAGAPEGCIGWIETPSI
EATQLLMTHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIEKSANIKRAVSDLI
LSKTFDNGVICASEQAVIIDEEIADEVKKLMKEYGCYFLNKDEIKKLEKFAIDEQSCAMS
PAVVGQPAAKIAEMAGFKVPEGTKILVAEYEGVGPKYPLSREKLSPILACYTVKDYNEGI
KKCEEMTEFGGLGHSAVIHSENQNVINEFARRVRTGRLIVNSPSSQGAIGDIYNTNTPSL
TLGCGSMGRNSTTDNVSVKNLLNIKRVVIRKDRMKWFKIPPKIYFESGSLQYLCKVKRKK
AFIVTDPFMVKLGFVDKVTYQLDKANIEYEIFSEVEPDPSVDTVMNGVKIMNSYNPDLII
AVGGGSAIDAAKGMWLFYEYPDTEFETLRLKFADIRKRAFKFPELGKKALFIAIPTTSGT
GSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDPDLTKTVPPSVTADTGMDVLTHAIEA
YVSVMASDYTDALAEKAIKIVFEYLPRAYKNGNDEEAREKMHNASCMAGMAFTNAFLGIN
HSMAHILGGKFHIPHGRANAILLPYVIRYNAEKPTKFVAFPQYEYPKAAERYAEIAKFLG
LPASTVEEGVESLIEAIKNLMKELNIPLTLKDAGINKEQFEKEIEEMSDIAFNDQCTGTN
PRMPLTKEIAEIYRKAYGA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacaaaaacggaattagacgttcagaagcagatagatctacttgtgtcaaga
gcacaagaggctcagaaaaaattcatgtcttacacgcaagagcaaatcgacgcaatagtt
aaggcaatggctttagcaggcgttgacaaacacgtagagctggcaaagatggcgtacgaa
gagacaaaaatgggtgtatacgaagataagataacaaaaaatctcttcgcaacagagtac
gtgtaccacgacataaaaaatgaaaagactgtaggaatcataaacgagaacatagaagaa
aactacatggaagtggcagaaccgataggcgtaattgccggtgtcacacctgtcacaaac
ccaacatctaccacgatgtttaaatgcttaatatccataaagacgcgaaatcctataata
ttcagcttccatccaaaggcaataaagtgcagcatcgcagcagccaaagtgatgtatgaa
gctgcactaaaggcaggcgcacctgaaggatgcataggatggatagaaacgccatcaatt
gaggccacacagcttctcatgacacatccaggcgtatcgctgatccttgcaacgggcggt
gcaggaatggtaaaagcggcatacagctcaggaaaaccggcattaggcgtaggtcctggc
aatgtgccatgctacatcgaaaaatcagcaaacataaagagggctgtatcggatctcata
ctaagcaagacatttgacaatggagtaatatgcgcatcagagcaggccgtaataatagac
gaggaaatagcagatgaagtcaaaaagcttatgaaagaatacggctgctacttcttaaac
aaagatgaaataaagaagcttgagaaatttgcaattgatgagcaaagctgcgccatgagc
cctgcagtggtaggtcagccagcggcgaagattgctgaaatggcaggcttcaaagtcccc
gaaggcacaaagatattagtggcagagtacgaaggagtaggtccaaaatatcctctatca
agggagaaactaagcccgattcttgcttgctacaccgtcaaagactacaatgaaggaatc
aaaaagtgcgaggaaatgactgaattcggaggtttaggccactctgctgtaatacactct
gaaaatcaaaacgtcataaatgaatttgcaaggcgagtccgcacaggaagacttatcgta
aattcaccatcatcacagggagcaataggagatatatacaatacaaacacgccatcactt
acattaggctgtggttctatgggaagaaactcaacgacagacaatgtaagcgtcaagaac
cttttgaatattaagcgtgtcgtgataaggaaggatagaatgaaatggttcaagattcca
ccgaagatttactttgaaagcgggtcactccagtacctgtgcaaagtcaaaagaaaaaaa
gcgtttatcgtcacagatccattcatggttaagcttggcttcgtagacaaagtgacatat
caattagacaaagcaaacatcgaatacgaaatattctcagaagtagagccagatccatct
gttgacacagtcatgaacggcgtaaaaataatgaattcgtacaatcctgacttaataatc
gctgtaggcggtggctctgcaatagacgcagcaaagggaatgtggcttttctacgaatat
cctgatacagagtttgaaacattgaggcttaaatttgcagacatcagaaaaagggcattt
aagttcccagaacttggcaaaaaagcgctattcatcgcaataccgacaacaagcggcaca
ggctcagaagtgacagcatttgccgtaataaccgacaaaaagagaaacatcaagtatcca
ctggcagactacgaacttacacctgacatagccataatagatcctgaccttacaaagact
gtaccgccatctgtaacagcagacacaggcatggatgtgctgacacacgccatagaagca
tacgtatcagtaatggcatcagactacacagatgcactggcggaaaaggctataaagatc
gtatttgaatacctgccaagggcttataaaaacggcaatgatgaagaagcccgcgaaaag
atgcacaatgcttcctgcatggctggtatggcattcacaaatgcattcttaggaataaac
cacagcatggcacacatactgggcggaaagttccacataccacacggaagagcaaatgca
atacttctgccgtatgtaataaggtacaatgcagaaaaacctacaaagtttgtggcattc
ccacaatacgaatatccaaaagcagcagaaagatatgcggaaatcgccaaattcttagga
ctgcctgcttcaactgttgaagaaggcgtagaaagcttaatagaagctataaagaacctc
atgaaagagcttaacattccgcttacacttaaagacgccggcatcaacaaagaacagttt
gaaaaagaaatagaggaaatgtcagacatcgccttcaacgatcagtgcacagggacaaac
ccgagaatgcctctcacaaaagaaattgcagagatctacagaaaagcatacggtgcatag

DBGET integrated database retrieval system