KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0615Help
Entry
Tsac_0615         CDS       T02137                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tsac_0615
DNA repair and recombination proteins [BR:tsh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tsac_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651111..651710
Genome map
AA seq 199 aa AA seqDB search
MNVYSRSLSKLIDELSRLPGIGRKTAQRLAFYILDMPLDDVVNLSNAILEAKNNLRYCKK
CYNFTDSELCSICSDETRDTHTICVVSDPKDVVAMEKTREYRGLYHVLHGAISPMDGIGP
EDIKVKELLERIKDTEINEIILATNPDIEGEATAMYIAKLIKPFGIKVTRIAHGVPVGGD
LEYTDSVTLSRALEGRREM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatattcgaggtcattatcaaagcttattgatgaattatcaagacttcccggc
attggacgtaagacggcccagaggctggcgttttacatcttagatatgcctttagatgat
gttgtcaacttgtctaatgctattttagaggcaaagaacaatttaagatactgtaaaaag
tgctataactttactgatagtgagctttgcagtatatgcagtgacgagacgagggataca
cataccatatgtgtagtttccgatcccaaagacgtagtagcgatggaaaagacgagggaa
tatagaggactataccacgtacttcatggtgcaatatcgcctatggatggaataggacca
gaggatataaaggtaaaagagttgttggagaggataaaagatactgaaatcaatgaaata
atattagccacaaatccagacatagagggtgaggcaactgcaatgtacatcgcaaagctg
ataaaaccttttggaataaaggtgacaagaattgcacacggtgtacctgtaggcggtgac
ctcgaatacacagattctgtaacgctgtcaagagctttagaaggcagaagggaaatgtaa

DBGET integrated database retrieval system