KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0697Help
Entry
Tsac_0697         CDS       T02137                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tsh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tsh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tsh00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738038..740227
Genome map
AA seq 729 aa AA seqDB search
MPIRYYEKSKSFKLDAKDTSYIMAIVDEEKFLGHVYFGEMIPDEDVNYLLRLDEPPYVPS
KNGRDRMSFLDSFPTEYPTSGLGDFREPCLKVMTKSGITACGIFYKSHKIYKGKPKLNGL
PSTFGNEDDCTTLEIKCVDNHLNLEVVLIYTVFEDLDAITRSVKVKNCSDEDIILTRVLS
VCVDFDRIDMDMVTLHGSWAREFHVKRRKVELGKQAVSSYRGETSHQANPFLALMDRNAT
EDFGEVYGFNLIYSGNFLAQVEGCQFDTTRVVMGINPFDFGWKLEPQEEFVAPEVVMVYS
NEGIGKMSRTFHDLYRNHLIRGEYKNKRRPVLINSWEAAYFDFDTDKLLRLAREASKLGI
EMLVMDDGWFGKRNSDNCSLGDWVVNEEKLKGGLKYLVDEVNKLGMKFGIWFEPEMVSPD
SDLYRAHPDWCIHIDGREGTLCRNQYVLDLSRKEVRDYVYGSVSNILRSANIEYVKWDMN
RQLSDVGNCVLPPDRQREIWHRYVLGVYEIMDRLTTEFPHIILENCSGGGGRFDPGMLYF
SPQIWLSDDTDAIERLKIQHGASYVYPVSTMGAHISDCPNHIVGRNTPFETRGLVALSGT
FGYELDVTKISQEDKDMIPKQIEMYKKYNNLIYNGDLYRIGNPFENIEFECVEYVSKDKN
EVLVIYVQILNRPNYHSRRIRLKGLEKDAFYRNEETDEVFSGSALMNGGILIKELKGDFR
GKLFHFVRV
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccgatacgttattatgagaagtcgaaatcatttaaacttgatgctaaagataccagt
tatataatggctatcgttgatgaagaaaagtttttaggacatgtctactttggagagatg
attcctgatgaagatgtgaattaccttttaagattagatgaacctccttatgttccttca
aagaatggaagagacaggatgtcgtttttagacagcttccctacagaataccctacaagt
ggtttgggggattttagagagccatgtttaaaggttatgacaaagtcaggaattactgcg
tgcgggattttttacaagtctcataaaatatataaaggcaagccaaaattaaatggcttg
ccatcaacgtttggcaatgaagatgactgtactacgcttgaaataaagtgtgttgataat
catttaaatttagaagttgttttgatttatacggtttttgaagatttagatgcaataacg
agaagtgtaaaagtaaaaaattgctctgatgaagatatcatattgacgagagtgttgtcc
gtatgtgttgattttgaccgaattgacatggatatggtaactttacatggctcatgggcc
agagaatttcatgtaaagagaaggaaagttgagcttgggaaacaagctgtttcatcatat
agaggtgagacaagtcatcaggcaaatccgtttttagctttaatggataggaatgccact
gaagattttggtgaagtttatgggtttaaccttatatattctggtaatttcttagcacaa
gtagaaggatgtcagtttgatacaactcgcgttgttatgggtataaatccatttgatttt
ggatggaaacttgaacctcaggaggaatttgtggcaccagaagtagtgatggtctattca
aacgaaggtattgggaaaatgtcacgaacttttcacgatctataccgcaatcatcttata
cgaggtgaatataaaaataaaagaagacctgtccttataaatagctgggaagctgcatat
tttgactttgatactgataagcttttgagattggcaagagaagcatcaaagctgggaatt
gagatgcttgtgatggacgatggttggtttggaaagcggaacagtgataattgttcttta
ggtgattgggtcgtcaatgaagaaaagttaaaaggagggcttaaatatttagtagatgaa
gtaaataaacttggcatgaagtttgggatatggtttgagcctgagatggtttcgccggat
tccgatctttatagggcacatccggattggtgcatacacatagatggaagagaaggtaca
ttgtgccgcaatcaatatgtattggatttgtccagaaaggaagtcagagattacgtttat
ggaagcgtaagcaatattttacgcagtgcaaacatagaatatgtaaagtgggatatgaat
aggcagcttagcgatgtcggaaattgtgtattgccacccgatcgtcagagagaaatatgg
cacagatatgttttaggcgtatatgaaattatggacaggcttacgacagaatttccgcat
atcattttggaaaattgctctggaggaggagggcgctttgaccctggaatgctgtatttc
agccctcagatatggctttcagatgatacagatgcgattgagaggcttaaaatccagcat
ggggcttcatacgtatatcctgtatcaacaatgggtgcccacataagcgattgtccaaac
cacattgttggaagaaacactccttttgagacgagaggacttgtagcattgtccgggact
tttggatatgaattggatgttacaaagatatctcaggaagacaaggacatgatacctaag
caaatagagatgtacaaaaagtacaataatttgatatacaatggggatttataccgtata
ggaaatccatttgaaaatatagagtttgaatgcgtagagtatgtttcaaaggacaagaat
gaggtgcttgttatatacgttcaaatcttgaataggcccaattaccacagcagaagaatc
cgattgaagggccttgagaaagatgctttttatcgcaacgaggagacagatgaagttttt
tcaggaagcgctcttatgaacggtggaatcctcataaaagaattgaaaggagactttaga
ggaaaattgtttcactttgtacgggtgtaa

DBGET integrated database retrieval system