KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0748Help
Entry
Tsac_0748         CDS       T02137                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00900  Terpenoid backbone biosynthesis
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tsac_0748
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tsac_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C MCR_alpha_N MvaI_BcnI
Motif
Other DBs
NCBI-ProteinID: AFK85770
UniProt: I3VTC5
Position
784274..785140
Genome map
AA seq 288 aa AA seqDB search
MNKLKAKSYAKINLALDVKGKRDDGYHFVEMVLQSIDLYDKLEFEMCDDIVLECERKDVP
TDRSNLIIKAADLLKREFGGYGVHIRLKKNIPVAAGLAGGSSNAAATLVALNKLWNLNIK
LPVLKDLAASLGADVPFCIEGGTKAASGIGDVLQDLETPHLRLLIVRPSVSVSTKDVYTE
YDNLAFIENNYTKNMIDAIRSGSIINICMKLGNDLERVTIRNYPIIGDIKKMMVERGALG
TLMSGSGPTVFGIFDDSKKLDAAYDSFVADGFYAYISNTIDKGIELYE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactaaaggcgaagtcgtacgcaaaaataaacttggcacttgatgtcaaaggg
aaaagagatgatggataccattttgttgagatggttttgcaatcgatagatttatatgat
aaattagaatttgagatgtgtgatgacatagttttggaatgcgagaggaaagacgtacct
acagatagatccaatttgatcataaaagcagcagatttattaaaaagggaatttggcgga
tacggtgttcatattagacttaaaaaaaacataccggttgcagcaggacttgctggcggc
agttcaaatgccgcggcaactttggtcgctttaaataagctttggaaccttaacataaaa
ctgcctgtattaaaagacttggctgcttctttaggtgctgatgtgcctttttgcatagaa
ggcggtacaaaagcggcttctggtataggtgatgtgcttcaagatttagaaacgccacat
ttaagattgttaatagtaaggccttctgtatctgtatcgacgaaagatgtgtatactgaa
tatgacaatcttgctttcatagaaaataattatactaaaaatatgattgatgccataaga
tcgggaagtatcataaacatttgtatgaaattaggaaatgatttagagcgggtgaccatc
agaaattatcctattataggcgatataaaaaagatgatggttgaaagaggagcattaggt
acccttatgagcggcagcggaccgacagtattcggcatctttgatgatagtaaaaaattg
gatgccgcttacgattcttttgtggctgatggattttatgcatatatttctaatactatt
gataaggggatagaactttatgaataa

DBGET integrated database retrieval system