KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0897Help
Entry
Tsac_0897         CDS       T02137                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Brite
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Tsac_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
938830..939465
Genome map
AA seq 211 aa AA seqDB search
MLNFKRIFTLICTFLVSLSLLTVTAFADTTNYWQDWTDGVGTVNASNLAGGQYSVSWTNC
GNFVVGKGWSTGSPSRVVNYNAGAFSPNGNGYLSLYGWTRSPLIEYYVVDDWGSYRPTGT
YMGTVTSDGGTYDIYTATRVNAPSIDGTQTFTQFWSVRQSKRSIGTNNTITFANHVNAWK
SHGMNLGSSWAYQIIATEGYQSSGYANVTVW
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgttaaactttaagagaatttttacgttaatttgcacttttttggttagtttaagtttg
cttacggttactgcatttgcagatacaacaaactactggcaagattggactgatggtgtt
ggaacagtaaatgcttctaatctagccggtggtcaatatagtgtttcatggacaaattgt
gggaattttgttgttggtaaaggttggagtactgggtcgccatctagagtagtaaactat
aatgctggagctttttcgccgaatggcaatgggtacttgtctctttatgggtggacaaga
agtccattaatagaatactacgttgtcgacgattggggtagctatagacctactggaacg
tatatgggtactgtgactagtgacggaggaacatatgatatatatacggccacaagagtt
aatgcaccttccattgatgggactcaaacatttactcaattttggagtgtcagacagtct
aagagatcaatcggaaccaacaacactataactttcgctaatcacgttaacgcatggaaa
agccatggaatgaatttaggtagtagttgggcttaccagataatagcaacagaaggatac
caaagcagtggttatgctaatgtaacagtttggtga

DBGET integrated database retrieval system