KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0957Help
Entry
Tsac_0957         CDS       T02137                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tsac_0957
Enzymes [BR:tsh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tsac_0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002668..1003234
Genome map
AA seq 188 aa AA seqDB search
MIDKEKIKKAVYDILEAIGEDPKREGLLETPDRVARMYEEIFSGLHENVMDVIKTFKEDE
HQEIVIVKDIPMYSMCEHHLLPFMGVAHVAYLPRKGTILGLSKLARIVDILAKKPQLQER
LTSEIADTIVKAANPLGVAVVVEAEHLCMTMRGIKKPGAKTVTSALRGLFKTDQRAREEV
MLLINGKR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatagataaagagaagataaaaaaagcggtgtacgacattcttgaagccataggtgaa
gaccctaaaagagaaggacttttagagacgcccgatagggttgccaggatgtacgaagaa
attttttcaggtcttcatgaaaatgtgatggatgtcataaagacatttaaagaagacgag
catcaagaaatagttatagtaaaagatattccaatgtactccatgtgtgaacatcatttg
ctgccatttatgggtgttgcccatgtggcgtatcttccgagaaaaggcacaattctggga
ctttcaaagctcgctagaatcgtcgatattttggccaaaaagcctcaactgcaggagagg
cttaccagcgagatcgctgatacgattgtaaaagccgcaaatcctttaggagttgcagtt
gtcgtagaggcagagcacctttgcatgacgatgcgaggcataaaaaaacctggagccaag
actgtaacgtctgcgcttaggggactatttaagacagatcaaagggcaagagaagaagtc
atgcttttgataaatggaaagcgatga

DBGET integrated database retrieval system