KEGG   Thermoanaerobacterium saccharolyticum: Tsac_0959Help
Entry
Tsac_0959         CDS       T02137                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tsac_0959
Enzymes [BR:tsh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tsac_0959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1004065..1004562
Genome map
AA seq 165 aa AA seqDB search
MTDVFLSIGSNIGDREEYLRNALIRLSENSVIIEKVSPIYETEPVGYKDQGKFLNAVVKV
KTELKPHELLKVVNSVEKELKRERTVRWGPRTIDIDILLYGDLVVDDDDLKIPHERMWER
AFVLIPLNDIAPYMTKDGEKLSCLIEMLPDKEDVKLLKRDWYKVV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgtctttttatcaattggctctaacatcggtgatagggaggaatacttgaga
aatgcccttataaggctttcagaaaattctgtcatcatagaaaaggtgtcgcccatctac
gagacagagcctgtaggttataaggatcaaggcaaatttttaaatgctgtagtaaaggta
aaaacggaacttaaaccgcatgaactgttaaaagttgtgaatagtgtggaaaaagagctt
aaaagagagagaactgtaagatggggtccaaggacgattgacatagacattcttctgtac
ggcgatttggttgtagatgatgacgatttaaaaataccccatgagcgcatgtgggaaaga
gcttttgtgttgattccacttaatgatattgcaccttatatgacgaaagatggggagaaa
ttgtcttgcctaatagagatgctgccggataaagaagacgtcaaactattaaagagagat
tggtacaaggtggtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system